BLASTX nr result
ID: Papaver25_contig00040740
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00040740 (641 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003552078.1| PREDICTED: mitochondrial ubiquitin ligase ac... 76 4e-18 ref|XP_003547746.1| PREDICTED: mitochondrial ubiquitin ligase ac... 77 1e-17 ref|XP_006576561.1| PREDICTED: mitochondrial ubiquitin ligase ac... 76 2e-17 ref|XP_003520919.1| PREDICTED: mitochondrial ubiquitin ligase ac... 76 2e-17 ref|XP_007135436.1| hypothetical protein PHAVU_010G129300g [Phas... 73 3e-17 gb|EXB23815.1| Mitochondrial ubiquitin ligase activator of nfkb ... 69 3e-16 ref|XP_002521326.1| ubiquitin-protein ligase, putative [Ricinus ... 70 9e-16 ref|XP_007024628.1| E3 Ubiquitin ligase family protein isoform 1... 69 2e-15 ref|XP_006849681.1| hypothetical protein AMTR_s00024p00236060 [A... 67 4e-15 ref|XP_006361337.1| PREDICTED: mitochondrial ubiquitin ligase ac... 62 6e-13 ref|XP_004252396.1| PREDICTED: mitochondrial ubiquitin ligase ac... 57 3e-11 ref|XP_002274016.1| PREDICTED: mitochondrial ubiquitin ligase ac... 74 3e-11 ref|XP_004510476.1| PREDICTED: mitochondrial ubiquitin ligase ac... 74 5e-11 ref|XP_003627295.1| Baculoviral IAP repeat-containing protein [M... 73 6e-11 ref|XP_004141700.1| PREDICTED: mitochondrial ubiquitin ligase ac... 70 5e-10 gb|ABK24069.1| unknown [Picea sitchensis] 55 1e-09 ref|XP_002303243.1| zinc finger family protein [Populus trichoca... 69 1e-09 ref|XP_001762119.1| predicted protein [Physcomitrella patens] gi... 57 3e-09 ref|XP_007215503.1| hypothetical protein PRUPE_ppa006914mg [Prun... 66 8e-09 ref|XP_006465920.1| PREDICTED: mitochondrial ubiquitin ligase ac... 50 2e-08 >ref|XP_003552078.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Glycine max] Length = 387 Score = 76.3 bits (186), Expect(3) = 4e-18 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = +3 Query: 105 DIGREVRSDYLFVNMDDSKHPLPLSTVYHKLTPVQTNSYTFLQAVSGHVYPV 260 D+GR ++Y+ VNMD S+HPLPL+TVYHKL P+ + YTFLQA+ GH YPV Sbjct: 163 DVGRRPNAEYVVVNMDGSRHPLPLTTVYHKLQPITASPYTFLQALFGHEYPV 214 Score = 34.3 bits (77), Expect(3) = 4e-18 Identities = 16/31 (51%), Positives = 26/31 (83%), Gaps = 1/31 (3%) Frame = +2 Query: 551 TEMTKDQLVEDMAFIKTTCLFWGGL-LGSLS 640 ++++KDQ++ D++ IKT LFWGG+ LGS+S Sbjct: 255 SDLSKDQMIMDLS-IKTKILFWGGIALGSMS 284 Score = 26.9 bits (58), Expect(3) = 4e-18 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +1 Query: 379 VGPLDEEKVLSIGTQISAV 435 VG LDEEK+L +G I+AV Sbjct: 214 VGLLDEEKILPLGKDITAV 232 >ref|XP_003547746.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1-like [Glycine max] Length = 383 Score = 76.6 bits (187), Expect(3) = 1e-17 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = +3 Query: 105 DIGREVRSDYLFVNMDDSKHPLPLSTVYHKLTPVQTNSYTFLQAVSGHVYPV 260 D+GR ++Y+ VNMD S+HPLPL+TVYHKL P+ + YTFLQA+ GH YPV Sbjct: 159 DVGRRPNAEYVVVNMDGSRHPLPLTTVYHKLQPINASPYTFLQALFGHEYPV 210 Score = 32.3 bits (72), Expect(3) = 1e-17 Identities = 15/31 (48%), Positives = 25/31 (80%), Gaps = 1/31 (3%) Frame = +2 Query: 551 TEMTKDQLVEDMAFIKTTCLFWGGL-LGSLS 640 ++++KDQ++ D++ IK LFWGG+ LGS+S Sbjct: 251 SDLSKDQMIVDLS-IKAKILFWGGISLGSMS 280 Score = 26.9 bits (58), Expect(3) = 1e-17 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +1 Query: 379 VGPLDEEKVLSIGTQISAV 435 VG LDEEK+L +G I+AV Sbjct: 210 VGLLDEEKILPLGKDITAV 228 >ref|XP_006576561.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-A-like isoform X2 [Glycine max] Length = 394 Score = 76.3 bits (186), Expect(3) = 2e-17 Identities = 33/52 (63%), Positives = 41/52 (78%) Frame = +3 Query: 105 DIGREVRSDYLFVNMDDSKHPLPLSTVYHKLTPVQTNSYTFLQAVSGHVYPV 260 D+GR ++Y+ VNMD S+HPLPLSTVYHKL P+ + YTFLQA+ GH YPV Sbjct: 164 DVGRWPNAEYVVVNMDGSRHPLPLSTVYHKLQPITASPYTFLQALFGHEYPV 215 Score = 32.0 bits (71), Expect(3) = 2e-17 Identities = 15/31 (48%), Positives = 25/31 (80%), Gaps = 1/31 (3%) Frame = +2 Query: 551 TEMTKDQLVEDMAFIKTTCLFWGGL-LGSLS 640 ++++KDQ++ D++ KT LFWGG+ LGS+S Sbjct: 262 SDLSKDQMIVDLS-SKTKILFWGGIALGSMS 291 Score = 26.9 bits (58), Expect(3) = 2e-17 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +1 Query: 379 VGPLDEEKVLSIGTQISAV 435 VG LDEEK+L +G I+AV Sbjct: 215 VGLLDEEKILPLGKNITAV 233 >ref|XP_003520919.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-A-like isoform X1 [Glycine max] Length = 388 Score = 76.3 bits (186), Expect(3) = 2e-17 Identities = 33/52 (63%), Positives = 41/52 (78%) Frame = +3 Query: 105 DIGREVRSDYLFVNMDDSKHPLPLSTVYHKLTPVQTNSYTFLQAVSGHVYPV 260 D+GR ++Y+ VNMD S+HPLPLSTVYHKL P+ + YTFLQA+ GH YPV Sbjct: 164 DVGRWPNAEYVVVNMDGSRHPLPLSTVYHKLQPITASPYTFLQALFGHEYPV 215 Score = 32.0 bits (71), Expect(3) = 2e-17 Identities = 15/31 (48%), Positives = 25/31 (80%), Gaps = 1/31 (3%) Frame = +2 Query: 551 TEMTKDQLVEDMAFIKTTCLFWGGL-LGSLS 640 ++++KDQ++ D++ KT LFWGG+ LGS+S Sbjct: 256 SDLSKDQMIVDLS-SKTKILFWGGIALGSMS 285 Score = 26.9 bits (58), Expect(3) = 2e-17 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +1 Query: 379 VGPLDEEKVLSIGTQISAV 435 VG LDEEK+L +G I+AV Sbjct: 215 VGLLDEEKILPLGKNITAV 233 >ref|XP_007135436.1| hypothetical protein PHAVU_010G129300g [Phaseolus vulgaris] gi|561008481|gb|ESW07430.1| hypothetical protein PHAVU_010G129300g [Phaseolus vulgaris] Length = 387 Score = 73.2 bits (178), Expect(3) = 3e-17 Identities = 31/52 (59%), Positives = 40/52 (76%) Frame = +3 Query: 105 DIGREVRSDYLFVNMDDSKHPLPLSTVYHKLTPVQTNSYTFLQAVSGHVYPV 260 D+G ++Y+ VNMD S+HPLPL+TVYHKL P+ + YTFLQA+ GH YPV Sbjct: 163 DVGWRPSTEYVVVNMDGSRHPLPLTTVYHKLQPINASPYTFLQALFGHEYPV 214 Score = 34.3 bits (77), Expect(3) = 3e-17 Identities = 16/31 (51%), Positives = 26/31 (83%), Gaps = 1/31 (3%) Frame = +2 Query: 551 TEMTKDQLVEDMAFIKTTCLFWGGL-LGSLS 640 ++++KDQ++ D++ IKT LFWGG+ LGS+S Sbjct: 255 SDLSKDQMIVDLS-IKTKILFWGGIALGSMS 284 Score = 26.9 bits (58), Expect(3) = 3e-17 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +1 Query: 379 VGPLDEEKVLSIGTQISAV 435 VG LDEEK+L +G ++AV Sbjct: 214 VGLLDEEKILPVGKDVTAV 232 >gb|EXB23815.1| Mitochondrial ubiquitin ligase activator of nfkb 1 [Morus notabilis] Length = 393 Score = 69.3 bits (168), Expect(3) = 3e-16 Identities = 30/52 (57%), Positives = 40/52 (76%) Frame = +3 Query: 105 DIGREVRSDYLFVNMDDSKHPLPLSTVYHKLTPVQTNSYTFLQAVSGHVYPV 260 + G+ + D++ VNMD S+HPLPL+TVYH+L PV + YTFLQA+ GH YPV Sbjct: 166 EAGKWPQMDFVVVNMDGSRHPLPLTTVYHQLQPVNPSPYTFLQALFGHEYPV 217 Score = 34.7 bits (78), Expect(3) = 3e-16 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 551 TEMTKDQLVEDMAFIKTTCLFWGGLLGSLS 640 TEMTKDQ+V D+AF L G +LGSLS Sbjct: 258 TEMTKDQMVVDLAFSTKVLLVSGIVLGSLS 287 Score = 26.9 bits (58), Expect(3) = 3e-16 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +1 Query: 379 VGPLDEEKVLSIGTQISAV 435 VG LDEEK+L +G I+AV Sbjct: 217 VGLLDEEKILPLGKDITAV 235 >ref|XP_002521326.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223539404|gb|EEF40994.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 387 Score = 70.1 bits (170), Expect(3) = 9e-16 Identities = 30/52 (57%), Positives = 40/52 (76%) Frame = +3 Query: 105 DIGREVRSDYLFVNMDDSKHPLPLSTVYHKLTPVQTNSYTFLQAVSGHVYPV 260 + GR +SDY+ VN+D S+HPLPL+TVYH+L P+ + YTFLQA G+ YPV Sbjct: 160 EAGRWPQSDYVIVNLDGSRHPLPLTTVYHQLQPIDASPYTFLQAFFGYEYPV 211 Score = 31.6 bits (70), Expect(3) = 9e-16 Identities = 16/31 (51%), Positives = 24/31 (77%), Gaps = 1/31 (3%) Frame = +2 Query: 551 TEMTKDQLVEDMAFIKTTCLFWGG-LLGSLS 640 ++++K+Q+V D+AF KT LFW G +LGS S Sbjct: 252 SDLSKEQMVVDLAF-KTKVLFWSGVVLGSFS 281 Score = 27.7 bits (60), Expect(3) = 9e-16 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +1 Query: 379 VGPLDEEKVLSIGTQISAV 435 VG LDEEK+L +G +I+AV Sbjct: 211 VGLLDEEKILPLGKEINAV 229 >ref|XP_007024628.1| E3 Ubiquitin ligase family protein isoform 1 [Theobroma cacao] gi|508779994|gb|EOY27250.1| E3 Ubiquitin ligase family protein isoform 1 [Theobroma cacao] Length = 386 Score = 68.9 bits (167), Expect(3) = 2e-15 Identities = 30/50 (60%), Positives = 39/50 (78%) Frame = +3 Query: 111 GREVRSDYLFVNMDDSKHPLPLSTVYHKLTPVQTNSYTFLQAVSGHVYPV 260 G+ +SD + VNMD S+HPLPL+TVYH+L P+ + YTFLQA+ GH YPV Sbjct: 162 GQWPQSDCVIVNMDGSRHPLPLTTVYHQLQPINASPYTFLQALFGHEYPV 211 Score = 31.6 bits (70), Expect(3) = 2e-15 Identities = 17/31 (54%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Frame = +2 Query: 551 TEMTKDQLVEDMAFIKTTCLFWGGL-LGSLS 640 ++ TKDQ++ D+AF KT L W G+ LGSLS Sbjct: 252 SDKTKDQMLLDLAF-KTKILLWSGMVLGSLS 281 Score = 27.7 bits (60), Expect(3) = 2e-15 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +1 Query: 379 VGPLDEEKVLSIGTQISAV 435 VG LDEEK+L +G +I+AV Sbjct: 211 VGLLDEEKILPLGKEITAV 229 >ref|XP_006849681.1| hypothetical protein AMTR_s00024p00236060 [Amborella trichopoda] gi|548853256|gb|ERN11262.1| hypothetical protein AMTR_s00024p00236060 [Amborella trichopoda] Length = 378 Score = 67.0 bits (162), Expect(3) = 4e-15 Identities = 28/50 (56%), Positives = 39/50 (78%) Frame = +3 Query: 111 GREVRSDYLFVNMDDSKHPLPLSTVYHKLTPVQTNSYTFLQAVSGHVYPV 260 G + SDY+ VN+++S+H LPL+TVYH+L P+Q +TFLQA+ GH YPV Sbjct: 158 GNWLCSDYVIVNLENSRHSLPLTTVYHQLRPIQATPFTFLQAIFGHGYPV 207 Score = 34.3 bits (77), Expect(3) = 4e-15 Identities = 15/26 (57%), Positives = 22/26 (84%) Frame = +2 Query: 551 TEMTKDQLVEDMAFIKTTCLFWGGLL 628 +++TKDQLV D+A ++T LFWGG+L Sbjct: 248 SDLTKDQLVADLA-LQTRFLFWGGIL 272 Score = 25.8 bits (55), Expect(3) = 4e-15 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +1 Query: 379 VGPLDEEKVLSIGTQISAV 435 VG LDEEK+L G +I+AV Sbjct: 207 VGILDEEKILPPGKEITAV 225 >ref|XP_006361337.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Solanum tuberosum] Length = 393 Score = 62.0 bits (149), Expect(3) = 6e-13 Identities = 28/52 (53%), Positives = 36/52 (69%) Frame = +3 Query: 105 DIGREVRSDYLFVNMDDSKHPLPLSTVYHKLTPVQTNSYTFLQAVSGHVYPV 260 + G+ + +Y+ VNMD S+HPLPL TVYH L P+ TFLQA+ GH YPV Sbjct: 166 ETGKWPQPEYVNVNMDGSRHPLPLVTVYHHLRPLHATPLTFLQALFGHHYPV 217 Score = 30.4 bits (67), Expect(3) = 6e-13 Identities = 13/26 (50%), Positives = 20/26 (76%) Frame = +2 Query: 551 TEMTKDQLVEDMAFIKTTCLFWGGLL 628 ++MTKDQ++ D+AF KT L W G++ Sbjct: 258 SDMTKDQMLVDLAF-KTKVLMWSGVV 282 Score = 27.3 bits (59), Expect(3) = 6e-13 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +1 Query: 379 VGPLDEEKVLSIGTQISAV 435 VG LDEEK+L +G I+AV Sbjct: 217 VGVLDEEKILPLGKDITAV 235 >ref|XP_004252396.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Solanum lycopersicum] Length = 391 Score = 57.0 bits (136), Expect(3) = 3e-11 Identities = 27/52 (51%), Positives = 33/52 (63%) Frame = +3 Query: 105 DIGREVRSDYLFVNMDDSKHPLPLSTVYHKLTPVQTNSYTFLQAVSGHVYPV 260 + GR + Y+ VNMD S H LPL TVYH L P+ TF+QA+ GH YPV Sbjct: 164 ETGRWPQPKYVNVNMDGSTHSLPLVTVYHHLQPLHATPLTFIQALFGHHYPV 215 Score = 30.0 bits (66), Expect(3) = 3e-11 Identities = 13/26 (50%), Positives = 20/26 (76%) Frame = +2 Query: 551 TEMTKDQLVEDMAFIKTTCLFWGGLL 628 ++MTKDQ++ ++AF KT L W G+L Sbjct: 256 SDMTKDQMLVELAF-KTKILMWSGVL 280 Score = 26.9 bits (58), Expect(3) = 3e-11 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +1 Query: 379 VGPLDEEKVLSIGTQISAV 435 VG LDEEK+L +G I+A+ Sbjct: 215 VGVLDEEKILPLGKDITAI 233 >ref|XP_002274016.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1 [Vitis vinifera] gi|297743001|emb|CBI35868.3| unnamed protein product [Vitis vinifera] Length = 391 Score = 74.3 bits (181), Expect = 3e-11 Identities = 40/77 (51%), Positives = 50/77 (64%) Frame = +3 Query: 111 GREVRSDYLFVNMDDSKHPLPLSTVYHKLTPVQTNSYTFLQAVSGHVYPVSFGNDSFA*A 290 GR +SDY+ VNMD S+HPLPL+TVYH+L PV + YTFLQA+ GH YPV ++ Sbjct: 167 GRWPQSDYVIVNMDGSRHPLPLTTVYHQLQPVNASPYTFLQALFGHDYPVGLLDEE---- 222 Query: 291 VDWLHLGKLWSFVGTFS 341 L LGK + VG S Sbjct: 223 -KLLPLGKEITAVGICS 238 >ref|XP_004510476.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Cicer arietinum] Length = 387 Score = 73.6 bits (179), Expect = 5e-11 Identities = 39/79 (49%), Positives = 50/79 (63%) Frame = +3 Query: 105 DIGREVRSDYLFVNMDDSKHPLPLSTVYHKLTPVQTNSYTFLQAVSGHVYPVSFGNDSFA 284 D+GR ++Y+ V+MD SKHPLPL+TVYHK+ P+ YTFLQA+ GH YPV ++ Sbjct: 163 DVGRRSSAEYVVVSMDGSKHPLPLTTVYHKMQPINPPVYTFLQALFGHEYPVGLLDEE-- 220 Query: 285 *AVDWLHLGKLWSFVGTFS 341 L LGK S VG S Sbjct: 221 ---KILPLGKDISAVGLCS 236 >ref|XP_003627295.1| Baculoviral IAP repeat-containing protein [Medicago truncatula] gi|66947626|emb|CAJ00009.1| C3HC4 zinc finger containing protein [Medicago truncatula] gi|355521317|gb|AET01771.1| Baculoviral IAP repeat-containing protein [Medicago truncatula] Length = 383 Score = 73.2 bits (178), Expect = 6e-11 Identities = 40/79 (50%), Positives = 48/79 (60%) Frame = +3 Query: 105 DIGREVRSDYLFVNMDDSKHPLPLSTVYHKLTPVQTNSYTFLQAVSGHVYPVSFGNDSFA 284 D+GR +Y+ VNMD S HPLPL+TVYH+L PV YTFLQA+ GH YPV ++ Sbjct: 159 DVGRPSNPEYVVVNMDGSSHPLPLTTVYHRLQPVNPPPYTFLQALFGHEYPVGLLDEE-- 216 Query: 285 *AVDWLHLGKLWSFVGTFS 341 L LGK S VG S Sbjct: 217 ---KILPLGKDVSAVGLCS 232 >ref|XP_004141700.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Cucumis sativus] gi|449480528|ref|XP_004155921.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Cucumis sativus] Length = 389 Score = 70.1 bits (170), Expect = 5e-10 Identities = 39/77 (50%), Positives = 47/77 (61%) Frame = +3 Query: 111 GREVRSDYLFVNMDDSKHPLPLSTVYHKLTPVQTNSYTFLQAVSGHVYPVSFGNDSFA*A 290 G SD++ VNM+ S+HPLPL+TVYH+L PV YTFLQAV GH YPV ++ Sbjct: 162 GHSTYSDFVVVNMEGSRHPLPLTTVYHQLQPVCATPYTFLQAVFGHEYPVGVLDEE---- 217 Query: 291 VDWLHLGKLWSFVGTFS 341 L LGK S VG S Sbjct: 218 -KILPLGKNISAVGICS 233 >gb|ABK24069.1| unknown [Picea sitchensis] Length = 394 Score = 55.5 bits (132), Expect(3) = 1e-09 Identities = 23/44 (52%), Positives = 32/44 (72%) Frame = +3 Query: 129 DYLFVNMDDSKHPLPLSTVYHKLTPVQTNSYTFLQAVSGHVYPV 260 +++ +N+D+S+H LPL TVYH L PVQ + YT QA+ G YPV Sbjct: 178 NFVHINLDESRHKLPLITVYHHLHPVQASPYTVFQAIFGRGYPV 221 Score = 30.4 bits (67), Expect(3) = 1e-09 Identities = 17/45 (37%), Positives = 24/45 (53%) Frame = +2 Query: 494 KWIIYFWWSNYVHAHSLLNTEMTKDQLVEDMAFIKTTCLFWGGLL 628 KW+ YF +++TKDQLVED+ K LFW G++ Sbjct: 256 KWLPYFL------------SDLTKDQLVEDITIGKAV-LFWSGVV 287 Score = 22.7 bits (47), Expect(3) = 1e-09 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 379 VGPLDEEKVLSIGTQISA 432 VG LDEEK+L G I+A Sbjct: 221 VGLLDEEKILPPGKVITA 238 >ref|XP_002303243.1| zinc finger family protein [Populus trichocarpa] gi|222840675|gb|EEE78222.1| zinc finger family protein [Populus trichocarpa] Length = 391 Score = 68.9 bits (167), Expect = 1e-09 Identities = 36/74 (48%), Positives = 47/74 (63%) Frame = +3 Query: 111 GREVRSDYLFVNMDDSKHPLPLSTVYHKLTPVQTNSYTFLQAVSGHVYPVSFGNDSFA*A 290 G+ +SDY+ VNMD S HPLPL+ VYH+L P+ + YTF+QA+ GH YPV ++ Sbjct: 167 GQWPQSDYVIVNMDGSSHPLPLTMVYHQLQPIVASRYTFIQALFGHEYPVGVLHEE---- 222 Query: 291 VDWLHLGKLWSFVG 332 L LGK S VG Sbjct: 223 -KILPLGKCISAVG 235 >ref|XP_001762119.1| predicted protein [Physcomitrella patens] gi|162686836|gb|EDQ73223.1| predicted protein [Physcomitrella patens] Length = 427 Score = 56.6 bits (135), Expect(2) = 3e-09 Identities = 23/43 (53%), Positives = 33/43 (76%) Frame = +3 Query: 132 YLFVNMDDSKHPLPLSTVYHKLTPVQTNSYTFLQAVSGHVYPV 260 Y+ +N+D+S+HP+PL TV+H+L PV +SYT QA+ G YPV Sbjct: 210 YVHINLDESQHPIPLVTVHHQLHPVPASSYTLFQAMFGRRYPV 252 Score = 31.2 bits (69), Expect(2) = 3e-09 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = +1 Query: 379 VGPLDEEKVLSIGTQISAVVFLH 447 VG LDEEK+L +G +I+AV LH Sbjct: 252 VGLLDEEKILPLGAEITAVGVLH 274 >ref|XP_007215503.1| hypothetical protein PRUPE_ppa006914mg [Prunus persica] gi|462411653|gb|EMJ16702.1| hypothetical protein PRUPE_ppa006914mg [Prunus persica] Length = 390 Score = 66.2 bits (160), Expect = 8e-09 Identities = 37/77 (48%), Positives = 48/77 (62%) Frame = +3 Query: 111 GREVRSDYLFVNMDDSKHPLPLSTVYHKLTPVQTNSYTFLQAVSGHVYPVSFGNDSFA*A 290 GR S+++ V+MD S+HPLPL+TVYH L PV + YTFL+A+ GH YPV ++ Sbjct: 164 GRRPISEFVAVDMDGSRHPLPLTTVYHHLHPVNPSPYTFLEALFGHRYPVGLLDEE---- 219 Query: 291 VDWLHLGKLWSFVGTFS 341 L LGK S VG S Sbjct: 220 -KILPLGKEISAVGLCS 235 >ref|XP_006465920.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1-like [Citrus sinensis] Length = 391 Score = 50.1 bits (118), Expect(3) = 2e-08 Identities = 22/46 (47%), Positives = 31/46 (67%) Frame = +3 Query: 123 RSDYLFVNMDDSKHPLPLSTVYHKLTPVQTNSYTFLQAVSGHVYPV 260 +SDY+ VNMD S+ PLPL+T Y +L + +TFLQA+ G P+ Sbjct: 170 QSDYIIVNMDGSRQPLPLTTAYQRLELANVSPFTFLQAMFGLKCPI 215 Score = 28.9 bits (63), Expect(3) = 2e-08 Identities = 16/31 (51%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Frame = +2 Query: 551 TEMTKDQLVEDMAFIKTTCLFWGGL-LGSLS 640 +E TKDQ+V D+ ++ LFW G+ LGSLS Sbjct: 256 SEKTKDQMVVDLV-NRSKILFWSGIVLGSLS 285 Score = 25.4 bits (54), Expect(3) = 2e-08 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +1 Query: 361 FPLFRKVGPLDEEKVLSIGTQISAV 435 F L +G L EEK+L +G ISAV Sbjct: 209 FGLKCPIGVLAEEKILPLGKDISAV 233