BLASTX nr result
ID: Papaver25_contig00040303
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00040303 (432 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006857388.1| hypothetical protein AMTR_s00067p00136180 [A... 58 2e-06 >ref|XP_006857388.1| hypothetical protein AMTR_s00067p00136180 [Amborella trichopoda] gi|548861481|gb|ERN18855.1| hypothetical protein AMTR_s00067p00136180 [Amborella trichopoda] Length = 685 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/48 (52%), Positives = 32/48 (66%) Frame = +2 Query: 8 ADLDNSFNCLPNSEEWEQGIVICKCLEVFYAITKKFSGVKYPTTNLYF 151 A D+ N +P+ +EWE+ IC CL++FY IT F G KYPT NLYF Sbjct: 401 AQCDSMCNMVPSEDEWERVKEICDCLKLFYDITNTFLGSKYPTANLYF 448