BLASTX nr result
ID: Papaver25_contig00039868
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00039868 (436 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007035251.1| Plasmodesmata-located protein 2 isoform 2 [T... 61 2e-07 ref|XP_007035250.1| Plasmodesmata-located protein 2 isoform 1 [T... 61 2e-07 ref|XP_007223188.1| hypothetical protein PRUPE_ppa009229mg [Prun... 60 3e-07 ref|XP_004157704.1| PREDICTED: cysteine-rich repeat secretory pr... 60 3e-07 ref|XP_004157649.1| PREDICTED: cysteine-rich repeat secretory pr... 60 3e-07 ref|XP_004134041.1| PREDICTED: cysteine-rich repeat secretory pr... 60 3e-07 ref|XP_002312597.2| hypothetical protein POPTR_0008s17150g [Popu... 60 4e-07 ref|XP_006379906.1| hypothetical protein POPTR_0008s17150g [Popu... 60 4e-07 ref|XP_002285462.1| PREDICTED: cysteine-rich repeat secretory pr... 60 4e-07 ref|XP_002526550.1| DUF26 domain-containing protein 2 precursor,... 60 4e-07 ref|XP_002528357.1| DUF26 domain-containing protein 2 precursor,... 60 4e-07 ref|XP_002311695.1| 33 kDa secretory family protein [Populus tri... 60 4e-07 emb|CAN81929.1| hypothetical protein VITISV_018684 [Vitis vinifera] 60 4e-07 ref|XP_006489637.1| PREDICTED: cysteine-rich repeat secretory pr... 59 5e-07 ref|XP_006489636.1| PREDICTED: cysteine-rich repeat secretory pr... 59 5e-07 ref|XP_007144134.1| hypothetical protein PHAVU_007G131500g [Phas... 59 5e-07 ref|XP_006420339.1| hypothetical protein CICLE_v10005547mg [Citr... 59 5e-07 ref|XP_006305424.1| hypothetical protein CARUB_v10009823mg [Caps... 59 5e-07 ref|XP_004296529.1| PREDICTED: cysteine-rich repeat secretory pr... 59 5e-07 ref|XP_004170650.1| PREDICTED: cysteine-rich repeat secretory pr... 59 5e-07 >ref|XP_007035251.1| Plasmodesmata-located protein 2 isoform 2 [Theobroma cacao] gi|508714280|gb|EOY06177.1| Plasmodesmata-located protein 2 isoform 2 [Theobroma cacao] Length = 300 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +1 Query: 1 QNQCGGAISGQIYLHKCYISYSYYPNGVPTK 93 Q +CG AISGQIYLHKC+ISYSYYPNGVP + Sbjct: 218 QVECGSAISGQIYLHKCFISYSYYPNGVPRR 248 >ref|XP_007035250.1| Plasmodesmata-located protein 2 isoform 1 [Theobroma cacao] gi|508714279|gb|EOY06176.1| Plasmodesmata-located protein 2 isoform 1 [Theobroma cacao] Length = 302 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +1 Query: 1 QNQCGGAISGQIYLHKCYISYSYYPNGVPTK 93 Q +CG AISGQIYLHKC+ISYSYYPNGVP + Sbjct: 218 QVECGSAISGQIYLHKCFISYSYYPNGVPRR 248 >ref|XP_007223188.1| hypothetical protein PRUPE_ppa009229mg [Prunus persica] gi|462420124|gb|EMJ24387.1| hypothetical protein PRUPE_ppa009229mg [Prunus persica] Length = 300 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 1 QNQCGGAISGQIYLHKCYISYSYYPNGVPTK 93 Q +CG AISGQIYLHKC++SYSYYPNGVP + Sbjct: 218 QVECGSAISGQIYLHKCFLSYSYYPNGVPRR 248 >ref|XP_004157704.1| PREDICTED: cysteine-rich repeat secretory protein 3-like [Cucumis sativus] Length = 274 Score = 60.1 bits (144), Expect = 3e-07 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +1 Query: 1 QNQCGGAISGQIYLHKCYISYSYYPNGVPTK 93 Q +CG +ISGQ+YLH+C+ISYSYYPNGVPT+ Sbjct: 221 QVECGSSISGQLYLHRCFISYSYYPNGVPTR 251 >ref|XP_004157649.1| PREDICTED: cysteine-rich repeat secretory protein 3-like [Cucumis sativus] Length = 301 Score = 60.1 bits (144), Expect = 3e-07 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +1 Query: 1 QNQCGGAISGQIYLHKCYISYSYYPNGVPTK 93 Q +CG +ISGQ+YLH+C+ISYSYYPNGVPT+ Sbjct: 221 QVECGSSISGQLYLHRCFISYSYYPNGVPTR 251 >ref|XP_004134041.1| PREDICTED: cysteine-rich repeat secretory protein 3-like [Cucumis sativus] Length = 301 Score = 60.1 bits (144), Expect = 3e-07 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +1 Query: 1 QNQCGGAISGQIYLHKCYISYSYYPNGVPTK 93 Q +CG +ISGQ+YLH+C+ISYSYYPNGVPT+ Sbjct: 221 QVECGSSISGQLYLHRCFISYSYYPNGVPTR 251 >ref|XP_002312597.2| hypothetical protein POPTR_0008s17150g [Populus trichocarpa] gi|550333266|gb|EEE89964.2| hypothetical protein POPTR_0008s17150g [Populus trichocarpa] Length = 292 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 1 QNQCGGAISGQIYLHKCYISYSYYPNGVPTK 93 Q +CG +ISGQIYLHKC+ISYSYYPNGVP + Sbjct: 211 QVECGNSISGQIYLHKCFISYSYYPNGVPRR 241 >ref|XP_006379906.1| hypothetical protein POPTR_0008s17150g [Populus trichocarpa] gi|550333265|gb|ERP57703.1| hypothetical protein POPTR_0008s17150g [Populus trichocarpa] Length = 255 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 1 QNQCGGAISGQIYLHKCYISYSYYPNGVPTK 93 Q +CG +ISGQIYLHKC+ISYSYYPNGVP + Sbjct: 211 QVECGNSISGQIYLHKCFISYSYYPNGVPRR 241 >ref|XP_002285462.1| PREDICTED: cysteine-rich repeat secretory protein 3 [Vitis vinifera] gi|296083727|emb|CBI23716.3| unnamed protein product [Vitis vinifera] Length = 295 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 1 QNQCGGAISGQIYLHKCYISYSYYPNGVPTK 93 Q +CG +ISGQIYLHKC+ISYSYYPNGVP + Sbjct: 214 QVECGSSISGQIYLHKCFISYSYYPNGVPRR 244 >ref|XP_002526550.1| DUF26 domain-containing protein 2 precursor, putative [Ricinus communis] gi|223534111|gb|EEF35828.1| DUF26 domain-containing protein 2 precursor, putative [Ricinus communis] Length = 299 Score = 59.7 bits (143), Expect = 4e-07 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = +1 Query: 1 QNQCGGAISGQIYLHKCYISYSYYPNGVPT 90 ++QCG + SGQ+YLHKC+ISYSYYPNGVPT Sbjct: 217 KDQCGDSTSGQVYLHKCFISYSYYPNGVPT 246 >ref|XP_002528357.1| DUF26 domain-containing protein 2 precursor, putative [Ricinus communis] gi|223532225|gb|EEF34029.1| DUF26 domain-containing protein 2 precursor, putative [Ricinus communis] Length = 296 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 1 QNQCGGAISGQIYLHKCYISYSYYPNGVPTK 93 Q +CG +ISGQIYLHKC+ISYSYYPNGVP + Sbjct: 214 QVECGNSISGQIYLHKCFISYSYYPNGVPRR 244 >ref|XP_002311695.1| 33 kDa secretory family protein [Populus trichocarpa] gi|222851515|gb|EEE89062.1| 33 kDa secretory family protein [Populus trichocarpa] Length = 294 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 1 QNQCGGAISGQIYLHKCYISYSYYPNGVPTK 93 Q +CG +ISGQIYLHKC+ISYSYYPNGVP + Sbjct: 211 QVECGNSISGQIYLHKCFISYSYYPNGVPRR 241 >emb|CAN81929.1| hypothetical protein VITISV_018684 [Vitis vinifera] Length = 523 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 1 QNQCGGAISGQIYLHKCYISYSYYPNGVPTK 93 Q +CG +ISGQIYLHKC+ISYSYYPNGVP + Sbjct: 214 QVECGSSISGQIYLHKCFISYSYYPNGVPRR 244 >ref|XP_006489637.1| PREDICTED: cysteine-rich repeat secretory protein 3-like isoform X2 [Citrus sinensis] Length = 293 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +1 Query: 1 QNQCGGAISGQIYLHKCYISYSYYPNGVPTK 93 Q +CG +ISGQ+YLHKC+ISYSYYPNGVP + Sbjct: 210 QVECGSSISGQVYLHKCFISYSYYPNGVPRR 240 >ref|XP_006489636.1| PREDICTED: cysteine-rich repeat secretory protein 3-like isoform X1 [Citrus sinensis] Length = 295 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +1 Query: 1 QNQCGGAISGQIYLHKCYISYSYYPNGVPTK 93 Q +CG +ISGQ+YLHKC+ISYSYYPNGVP + Sbjct: 210 QVECGSSISGQVYLHKCFISYSYYPNGVPRR 240 >ref|XP_007144134.1| hypothetical protein PHAVU_007G131500g [Phaseolus vulgaris] gi|561017324|gb|ESW16128.1| hypothetical protein PHAVU_007G131500g [Phaseolus vulgaris] Length = 296 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +1 Query: 7 QCGGAISGQIYLHKCYISYSYYPNGVPTK 93 +CG +ISGQ+YLHKC+ISYSYYPNGVP K Sbjct: 212 ECGSSISGQVYLHKCFISYSYYPNGVPGK 240 >ref|XP_006420339.1| hypothetical protein CICLE_v10005547mg [Citrus clementina] gi|557522212|gb|ESR33579.1| hypothetical protein CICLE_v10005547mg [Citrus clementina] Length = 293 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +1 Query: 1 QNQCGGAISGQIYLHKCYISYSYYPNGVPTK 93 Q +CG +ISGQ+YLHKC+ISYSYYPNGVP + Sbjct: 210 QVECGSSISGQVYLHKCFISYSYYPNGVPRR 240 >ref|XP_006305424.1| hypothetical protein CARUB_v10009823mg [Capsella rubella] gi|482574135|gb|EOA38322.1| hypothetical protein CARUB_v10009823mg [Capsella rubella] Length = 310 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +1 Query: 1 QNQCGGAISGQIYLHKCYISYSYYPNGVPTK 93 Q +CG AISGQIYLHKC+++YSYYPNGVP + Sbjct: 216 QVECGSAISGQIYLHKCFVAYSYYPNGVPRR 246 >ref|XP_004296529.1| PREDICTED: cysteine-rich repeat secretory protein 3-like [Fragaria vesca subsp. vesca] Length = 299 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +1 Query: 1 QNQCGGAISGQIYLHKCYISYSYYPNGVPTK 93 Q +CG +ISGQIYLHKC++SYSYYPNGVP + Sbjct: 216 QVECGNSISGQIYLHKCFVSYSYYPNGVPRR 246 >ref|XP_004170650.1| PREDICTED: cysteine-rich repeat secretory protein 3-like [Cucumis sativus] Length = 303 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +1 Query: 1 QNQCGGAISGQIYLHKCYISYSYYPNGVPTK 93 Q +CG +ISGQ+YLHKC+ISYSYYPNGVP + Sbjct: 217 QVECGSSISGQVYLHKCFISYSYYPNGVPKR 247