BLASTX nr result
ID: Papaver25_contig00039157
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00039157 (662 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGZ20103.1| pentatricopeptide repeat-containing protein [Came... 82 1e-13 ref|XP_007051704.1| Pentatricopeptide repeat superfamily protein... 81 3e-13 ref|XP_002275491.1| PREDICTED: pentatricopeptide repeat-containi... 78 3e-12 ref|XP_003548443.1| PREDICTED: pentatricopeptide repeat-containi... 77 4e-12 gb|EXB51620.1| hypothetical protein L484_012912 [Morus notabilis] 74 5e-11 ref|XP_006491189.1| PREDICTED: pentatricopeptide repeat-containi... 74 5e-11 ref|XP_006444949.1| hypothetical protein CICLE_v100190671mg, par... 74 5e-11 ref|XP_006339632.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-10 ref|XP_002320827.2| pentatricopeptide repeat-containing family p... 72 1e-10 ref|XP_007220199.1| hypothetical protein PRUPE_ppa003068mg [Prun... 72 1e-10 ref|XP_004231193.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-10 ref|XP_007160491.1| hypothetical protein PHAVU_002G326200g [Phas... 72 2e-10 ref|XP_004503311.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-10 ref|XP_004503310.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-10 ref|XP_004308336.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-09 ref|XP_004139715.1| PREDICTED: pentatricopeptide repeat-containi... 68 3e-09 gb|EPS64106.1| hypothetical protein M569_10673, partial [Genlise... 66 9e-09 gb|EYU32173.1| hypothetical protein MIMGU_mgv1a002389mg [Mimulus... 65 2e-08 ref|XP_004300812.1| PREDICTED: pentatricopeptide repeat-containi... 64 4e-08 ref|XP_004301483.1| PREDICTED: pentatricopeptide repeat-containi... 64 6e-08 >gb|AGZ20103.1| pentatricopeptide repeat-containing protein [Camellia sinensis] Length = 771 Score = 82.4 bits (202), Expect = 1e-13 Identities = 37/57 (64%), Positives = 47/57 (82%) Frame = -2 Query: 172 LTDGFAKAGEIEMSLNLFDQMNEEGVSPDVVTLNVLVDGMCKHERVGSALEFFSKMK 2 L DGF K+GEI + LFDQMN+EGV P+V+TLN LVDGMCKH R+ SA+EFF++M+ Sbjct: 428 LIDGFCKSGEIGRAHELFDQMNKEGVPPNVITLNTLVDGMCKHGRINSAMEFFNEMQ 484 >ref|XP_007051704.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] gi|508703965|gb|EOX95861.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] Length = 764 Score = 80.9 bits (198), Expect = 3e-13 Identities = 37/57 (64%), Positives = 44/57 (77%) Frame = -2 Query: 172 LTDGFAKAGEIEMSLNLFDQMNEEGVSPDVVTLNVLVDGMCKHERVGSALEFFSKMK 2 L DGF K GEIE L+D+M EEGVSP+V+TLN LVDGMC+H R SALEFF+ M+ Sbjct: 421 LIDGFCKVGEIERGKELYDRMKEEGVSPNVITLNTLVDGMCRHGRTSSALEFFNDMQ 477 >ref|XP_002275491.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial [Vitis vinifera] gi|297745328|emb|CBI40408.3| unnamed protein product [Vitis vinifera] Length = 765 Score = 77.8 bits (190), Expect = 3e-12 Identities = 35/57 (61%), Positives = 45/57 (78%) Frame = -2 Query: 172 LTDGFAKAGEIEMSLNLFDQMNEEGVSPDVVTLNVLVDGMCKHERVGSALEFFSKMK 2 L DG+ KA IE + LFDQMN++GV P+VVTLN LVDGMCKH R+ A+EFF++M+ Sbjct: 422 LIDGYCKASMIEAARELFDQMNKDGVPPNVVTLNTLVDGMCKHGRINGAVEFFNEMQ 478 >ref|XP_003548443.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Glycine max] Length = 746 Score = 77.4 bits (189), Expect = 4e-12 Identities = 36/57 (63%), Positives = 44/57 (77%) Frame = -2 Query: 172 LTDGFAKAGEIEMSLNLFDQMNEEGVSPDVVTLNVLVDGMCKHERVGSALEFFSKMK 2 L DGF KAG + + LF QMNEEGV P+V+TLN LVDG+CKH RV A+EFF++MK Sbjct: 399 LIDGFFKAGNFDRAHELFRQMNEEGVQPNVITLNTLVDGLCKHGRVHRAVEFFNEMK 455 >gb|EXB51620.1| hypothetical protein L484_012912 [Morus notabilis] Length = 769 Score = 73.6 bits (179), Expect = 5e-11 Identities = 36/57 (63%), Positives = 41/57 (71%) Frame = -2 Query: 172 LTDGFAKAGEIEMSLNLFDQMNEEGVSPDVVTLNVLVDGMCKHERVGSALEFFSKMK 2 L DGF K GEIE L +FDQM + V PDVVTLN LVDGMCK RVGSA++ F M+ Sbjct: 417 LIDGFNKVGEIERGLKIFDQMKRDQVPPDVVTLNTLVDGMCKLGRVGSAVKLFDVMQ 473 >ref|XP_006491189.1| PREDICTED: pentatricopeptide repeat-containing protein At5g28460-like [Citrus sinensis] Length = 757 Score = 73.6 bits (179), Expect = 5e-11 Identities = 33/56 (58%), Positives = 43/56 (76%) Frame = -2 Query: 172 LTDGFAKAGEIEMSLNLFDQMNEEGVSPDVVTLNVLVDGMCKHERVGSALEFFSKM 5 L +GF K+G IE L LF M +EGV+P+VVTLN LVDGMC+H R+ SA+EFF ++ Sbjct: 414 LINGFCKSGNIEKGLELFHLMKQEGVTPNVVTLNTLVDGMCRHGRINSAVEFFQEV 469 >ref|XP_006444949.1| hypothetical protein CICLE_v100190671mg, partial [Citrus clementina] gi|557547211|gb|ESR58189.1| hypothetical protein CICLE_v100190671mg, partial [Citrus clementina] Length = 450 Score = 73.6 bits (179), Expect = 5e-11 Identities = 33/56 (58%), Positives = 43/56 (76%) Frame = -2 Query: 172 LTDGFAKAGEIEMSLNLFDQMNEEGVSPDVVTLNVLVDGMCKHERVGSALEFFSKM 5 L +GF K+G IE L LF M +EGV+P+VVTLN LVDGMC+H R+ SA+EFF ++ Sbjct: 107 LINGFCKSGNIEKGLELFHLMKQEGVTPNVVTLNTLVDGMCRHGRINSAVEFFQEV 162 >ref|XP_006339632.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Solanum tuberosum] Length = 761 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/57 (59%), Positives = 43/57 (75%) Frame = -2 Query: 172 LTDGFAKAGEIEMSLNLFDQMNEEGVSPDVVTLNVLVDGMCKHERVGSALEFFSKMK 2 L DGF KAGEIE SL LFDQM + V P+V+T+N L+ GMCK RV SA+ FF++M+ Sbjct: 418 LIDGFCKAGEIERSLELFDQMKMDRVVPNVITMNTLLHGMCKFGRVSSAMSFFAEMQ 474 >ref|XP_002320827.2| pentatricopeptide repeat-containing family protein, partial [Populus trichocarpa] gi|550323783|gb|EEE99142.2| pentatricopeptide repeat-containing family protein, partial [Populus trichocarpa] Length = 720 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/53 (64%), Positives = 41/53 (77%) Frame = -2 Query: 172 LTDGFAKAGEIEMSLNLFDQMNEEGVSPDVVTLNVLVDGMCKHERVGSALEFF 14 L DGF KAGEIE LFD+MN+EGV+P+VVT+N LV GMC+ RV SA+ FF Sbjct: 382 LIDGFCKAGEIEKGKELFDEMNKEGVAPNVVTVNTLVGGMCRTGRVSSAVNFF 434 >ref|XP_007220199.1| hypothetical protein PRUPE_ppa003068mg [Prunus persica] gi|462416661|gb|EMJ21398.1| hypothetical protein PRUPE_ppa003068mg [Prunus persica] Length = 607 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/57 (56%), Positives = 42/57 (73%) Frame = -2 Query: 172 LTDGFAKAGEIEMSLNLFDQMNEEGVSPDVVTLNVLVDGMCKHERVGSALEFFSKMK 2 L DGF K G+IE LF QM EEG+SP V+TLN +VD +CKH R+ SA+EF ++M+ Sbjct: 264 LIDGFNKVGDIERGCELFHQMKEEGISPSVITLNTMVDCLCKHGRLNSAIEFLNEMQ 320 >ref|XP_004231193.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Solanum lycopersicum] Length = 761 Score = 72.4 bits (176), Expect = 1e-10 Identities = 33/57 (57%), Positives = 44/57 (77%) Frame = -2 Query: 172 LTDGFAKAGEIEMSLNLFDQMNEEGVSPDVVTLNVLVDGMCKHERVGSALEFFSKMK 2 L DG+ KAGEIE SL LFDQM ++ V P+V+T+N L+ GMCK RV SA+ FF++M+ Sbjct: 418 LIDGYCKAGEIERSLELFDQMKKDRVVPNVITMNTLLHGMCKFGRVSSAMRFFAEMQ 474 >ref|XP_007160491.1| hypothetical protein PHAVU_002G326200g [Phaseolus vulgaris] gi|561033906|gb|ESW32485.1| hypothetical protein PHAVU_002G326200g [Phaseolus vulgaris] Length = 760 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/57 (57%), Positives = 43/57 (75%) Frame = -2 Query: 172 LTDGFAKAGEIEMSLNLFDQMNEEGVSPDVVTLNVLVDGMCKHERVGSALEFFSKMK 2 L DGF KAG I + L+ QM EEGV P VVTLN +V+G+CKH +V +A+EFF++MK Sbjct: 409 LIDGFCKAGNIGKARELYSQMIEEGVQPSVVTLNTMVNGLCKHGKVHNAVEFFNEMK 465 >ref|XP_004503311.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like isoform X2 [Cicer arietinum] Length = 643 Score = 71.6 bits (174), Expect = 2e-10 Identities = 36/57 (63%), Positives = 42/57 (73%) Frame = -2 Query: 172 LTDGFAKAGEIEMSLNLFDQMNEEGVSPDVVTLNVLVDGMCKHERVGSALEFFSKMK 2 L DGF KAG I+ + LF MNEEGV P+VVTLN LV GMCK RV SA+EF ++MK Sbjct: 288 LIDGFCKAGNIDKARELFGLMNEEGVQPNVVTLNTLVGGMCKIGRVYSAVEFLNEMK 344 >ref|XP_004503310.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like isoform X1 [Cicer arietinum] Length = 776 Score = 71.6 bits (174), Expect = 2e-10 Identities = 36/57 (63%), Positives = 42/57 (73%) Frame = -2 Query: 172 LTDGFAKAGEIEMSLNLFDQMNEEGVSPDVVTLNVLVDGMCKHERVGSALEFFSKMK 2 L DGF KAG I+ + LF MNEEGV P+VVTLN LV GMCK RV SA+EF ++MK Sbjct: 421 LIDGFCKAGNIDKARELFGLMNEEGVQPNVVTLNTLVGGMCKIGRVYSAVEFLNEMK 477 >ref|XP_004308336.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 883 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/57 (52%), Positives = 43/57 (75%) Frame = -2 Query: 172 LTDGFAKAGEIEMSLNLFDQMNEEGVSPDVVTLNVLVDGMCKHERVGSALEFFSKMK 2 L GF K G+I+ L LF++M EEG+ +VVTLN L+DG+C+H R+ +ALEFF +M+ Sbjct: 389 LIGGFNKVGDIDRGLELFEKMKEEGIPLNVVTLNTLLDGLCRHGRLNAALEFFKEMQ 445 >ref|XP_004139715.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Cucumis sativus] gi|449475521|ref|XP_004154479.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Cucumis sativus] Length = 660 Score = 67.8 bits (164), Expect = 3e-09 Identities = 28/57 (49%), Positives = 43/57 (75%) Frame = -2 Query: 172 LTDGFAKAGEIEMSLNLFDQMNEEGVSPDVVTLNVLVDGMCKHERVGSALEFFSKMK 2 L +G+ ++GEIE++ LF++M + P+V+TLN LVDGMCKH R+ +A+EFF M+ Sbjct: 269 LINGYCRSGEIEVAHKLFNEMENAQIEPNVITLNTLVDGMCKHNRISTAVEFFRVMQ 325 >gb|EPS64106.1| hypothetical protein M569_10673, partial [Genlisea aurea] Length = 491 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/57 (56%), Positives = 38/57 (66%) Frame = -2 Query: 172 LTDGFAKAGEIEMSLNLFDQMNEEGVSPDVVTLNVLVDGMCKHERVGSALEFFSKMK 2 L DGF KAGE++ LFD MN GV +VVTLN L+DGMCK RVGSA+ M+ Sbjct: 155 LIDGFCKAGEVDKGKELFDTMNGRGVPQNVVTLNTLLDGMCKLGRVGSAMALLDSME 211 >gb|EYU32173.1| hypothetical protein MIMGU_mgv1a002389mg [Mimulus guttatus] Length = 680 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/51 (58%), Positives = 40/51 (78%) Frame = -2 Query: 154 KAGEIEMSLNLFDQMNEEGVSPDVVTLNVLVDGMCKHERVGSALEFFSKMK 2 +AGEI+ LF+QM++EGV +VVTLN LVDGMCKH RV SA+E F+ ++ Sbjct: 343 EAGEIDKGNELFEQMSKEGVEINVVTLNTLVDGMCKHGRVSSAMELFNNIR 393 >ref|XP_004300812.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 763 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/58 (50%), Positives = 42/58 (72%) Frame = -2 Query: 175 ILTDGFAKAGEIEMSLNLFDQMNEEGVSPDVVTLNVLVDGMCKHERVGSALEFFSKMK 2 IL DGF K G+IE LFD+M EEG+ +V TLN ++DG+ + R+ +ALEFF++M+ Sbjct: 411 ILIDGFNKVGDIEKGRELFDKMKEEGIPMNVSTLNTMLDGLSRRGRLNTALEFFNEME 468 >ref|XP_004301483.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 771 Score = 63.5 bits (153), Expect = 6e-08 Identities = 29/58 (50%), Positives = 42/58 (72%) Frame = -2 Query: 175 ILTDGFAKAGEIEMSLNLFDQMNEEGVSPDVVTLNVLVDGMCKHERVGSALEFFSKMK 2 IL DGF K G+IE LFD+M EEG+ +V TLN ++DG+ + R+ +ALEFF++M+ Sbjct: 418 ILIDGFNKVGDIEKGHELFDKMKEEGIPMNVSTLNTMLDGLSRRGRLNTALEFFNEME 475