BLASTX nr result
ID: Papaver25_contig00039059
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00039059 (472 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004974062.1| PREDICTED: solute carrier family 35 member F... 44 6e-06 ref|XP_004974063.1| PREDICTED: solute carrier family 35 member F... 44 6e-06 >ref|XP_004974062.1| PREDICTED: solute carrier family 35 member F1-like isoform X3 [Setaria italica] Length = 405 Score = 44.3 bits (103), Expect(2) = 6e-06 Identities = 15/30 (50%), Positives = 24/30 (80%) Frame = +1 Query: 337 LSLLTSSVWVVIIRVYVFHQNIQWLYCVSF 426 LSLLTS +W V+IR++ +H+ + W+Y V+F Sbjct: 270 LSLLTSDMWAVLIRIFAYHEKVDWIYFVAF 299 Score = 31.2 bits (69), Expect(2) = 6e-06 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +2 Query: 260 LWLAVSAFVFYSTVPYVLKLGGSVL 334 L AV+ F+FYSTVP VLK+ G+ + Sbjct: 243 LGFAVAMFLFYSTVPTVLKICGATM 267 >ref|XP_004974063.1| PREDICTED: solute carrier family 35 member F1-like isoform X4 [Setaria italica] Length = 368 Score = 44.3 bits (103), Expect(2) = 6e-06 Identities = 15/30 (50%), Positives = 24/30 (80%) Frame = +1 Query: 337 LSLLTSSVWVVIIRVYVFHQNIQWLYCVSF 426 LSLLTS +W V+IR++ +H+ + W+Y V+F Sbjct: 270 LSLLTSDMWAVLIRIFAYHEKVDWIYFVAF 299 Score = 31.2 bits (69), Expect(2) = 6e-06 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +2 Query: 260 LWLAVSAFVFYSTVPYVLKLGGSVL 334 L AV+ F+FYSTVP VLK+ G+ + Sbjct: 243 LGFAVAMFLFYSTVPTVLKICGATM 267