BLASTX nr result
ID: Papaver25_contig00039054
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00039054 (590 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37486.1| hypothetical protein MIMGU_mgv1a003146mg [Mimulus... 57 4e-06 ref|XP_006858622.1| hypothetical protein AMTR_s00066p00025940 [A... 57 4e-06 ref|XP_002528281.1| rnase l inhibitor, putative [Ricinus communi... 56 4e-06 ref|XP_003589457.1| RNase L inhibitor protein-like protein, part... 56 6e-06 ref|XP_006430899.1| hypothetical protein CICLE_v10011325mg [Citr... 55 7e-06 ref|XP_006430898.1| hypothetical protein CICLE_v10011325mg [Citr... 55 7e-06 ref|XP_006385402.1| hypothetical protein POPTR_0003s03960g [Popu... 56 8e-06 ref|XP_002516768.1| rnase l inhibitor, putative [Ricinus communi... 56 8e-06 ref|XP_002303221.1| RNase L inhibitor family protein [Populus tr... 56 8e-06 >gb|EYU37486.1| hypothetical protein MIMGU_mgv1a003146mg [Mimulus guttatus] Length = 605 Score = 57.0 bits (136), Expect = 4e-06 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -2 Query: 589 TANAPQSPSTGMDLFLSKLDITIRRDPDNSKPWINELD 476 TANAPQS TGM+LFLS LDIT RRDP N +P IN+LD Sbjct: 550 TANAPQSLLTGMNLFLSHLDITFRRDPTNFRPRINKLD 587 >ref|XP_006858622.1| hypothetical protein AMTR_s00066p00025940 [Amborella trichopoda] gi|548862733|gb|ERN20089.1| hypothetical protein AMTR_s00066p00025940 [Amborella trichopoda] Length = 606 Score = 57.0 bits (136), Expect = 4e-06 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -2 Query: 589 TANAPQSPSTGMDLFLSKLDITIRRDPDNSKPWINELD 476 TANAPQS TGM+LFLS LDIT RRDP N +P IN+LD Sbjct: 551 TANAPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLD 588 >ref|XP_002528281.1| rnase l inhibitor, putative [Ricinus communis] gi|223532318|gb|EEF34119.1| rnase l inhibitor, putative [Ricinus communis] Length = 591 Score = 55.8 bits (133), Expect(2) = 4e-06 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -2 Query: 589 TANAPQSPSTGMDLFLSKLDITIRRDPDNSKPWINELD 476 TAN+PQS TGM+LFLS LDIT RRDP N +P IN+LD Sbjct: 536 TANSPQSLLTGMNLFLSHLDITFRRDPTNFRPRINKLD 573 Score = 20.8 bits (42), Expect(2) = 4e-06 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -1 Query: 470 DQKPSGF*YYLDE 432 DQK +G YYLD+ Sbjct: 579 DQKAAGSYYYLDD 591 >ref|XP_003589457.1| RNase L inhibitor protein-like protein, partial [Medicago truncatula] gi|355478505|gb|AES59708.1| RNase L inhibitor protein-like protein, partial [Medicago truncatula] Length = 670 Score = 56.2 bits (134), Expect = 6e-06 Identities = 30/51 (58%), Positives = 37/51 (72%) Frame = -2 Query: 589 TANAPQSPSTGMDLFLSKLDITIRRDPDNSKPWINELDPLTKNLQAFNITL 437 TAN PQS TGM+LFLS LDIT RRDP N +P IN+L+ TK+ + N+ L Sbjct: 565 TANCPQSLLTGMNLFLSHLDITFRRDPTNFRPRINKLES-TKDREQKNVCL 614 >ref|XP_006430899.1| hypothetical protein CICLE_v10011325mg [Citrus clementina] gi|567876621|ref|XP_006430900.1| hypothetical protein CICLE_v10011325mg [Citrus clementina] gi|568857601|ref|XP_006482353.1| PREDICTED: ABC transporter E family member 2-like [Citrus sinensis] gi|557532956|gb|ESR44139.1| hypothetical protein CICLE_v10011325mg [Citrus clementina] gi|557532957|gb|ESR44140.1| hypothetical protein CICLE_v10011325mg [Citrus clementina] Length = 605 Score = 55.1 bits (131), Expect(2) = 7e-06 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -2 Query: 586 ANAPQSPSTGMDLFLSKLDITIRRDPDNSKPWINELD 476 ANAPQS TGM+LFLS LDIT RRDP N +P IN+LD Sbjct: 551 ANAPQSLLTGMNLFLSHLDITFRRDPTNFRPRINKLD 587 Score = 20.8 bits (42), Expect(2) = 7e-06 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -1 Query: 470 DQKPSGF*YYLDE 432 DQK +G YYLD+ Sbjct: 593 DQKAAGSYYYLDD 605 >ref|XP_006430898.1| hypothetical protein CICLE_v10011325mg [Citrus clementina] gi|557532955|gb|ESR44138.1| hypothetical protein CICLE_v10011325mg [Citrus clementina] Length = 584 Score = 55.1 bits (131), Expect(2) = 7e-06 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -2 Query: 586 ANAPQSPSTGMDLFLSKLDITIRRDPDNSKPWINELD 476 ANAPQS TGM+LFLS LDIT RRDP N +P IN+LD Sbjct: 530 ANAPQSLLTGMNLFLSHLDITFRRDPTNFRPRINKLD 566 Score = 20.8 bits (42), Expect(2) = 7e-06 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -1 Query: 470 DQKPSGF*YYLDE 432 DQK +G YYLD+ Sbjct: 572 DQKAAGSYYYLDD 584 >ref|XP_006385402.1| hypothetical protein POPTR_0003s03960g [Populus trichocarpa] gi|550342354|gb|ERP63199.1| hypothetical protein POPTR_0003s03960g [Populus trichocarpa] Length = 605 Score = 55.8 bits (133), Expect = 8e-06 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -2 Query: 589 TANAPQSPSTGMDLFLSKLDITIRRDPDNSKPWINELD 476 TAN+PQS TGM+LFLS LDIT RRDP N +P IN+LD Sbjct: 550 TANSPQSLLTGMNLFLSHLDITFRRDPTNFRPRINKLD 587 >ref|XP_002516768.1| rnase l inhibitor, putative [Ricinus communis] gi|223544141|gb|EEF45666.1| rnase l inhibitor, putative [Ricinus communis] Length = 126 Score = 55.8 bits (133), Expect = 8e-06 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -2 Query: 589 TANAPQSPSTGMDLFLSKLDITIRRDPDNSKPWINELD 476 TAN+PQS TGM+LFLS LDIT RRDP N +P IN+LD Sbjct: 71 TANSPQSLLTGMNLFLSHLDITFRRDPTNYRPKINKLD 108 >ref|XP_002303221.1| RNase L inhibitor family protein [Populus trichocarpa] gi|222840653|gb|EEE78200.1| RNase L inhibitor family protein [Populus trichocarpa] Length = 611 Score = 55.8 bits (133), Expect = 8e-06 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -2 Query: 589 TANAPQSPSTGMDLFLSKLDITIRRDPDNSKPWINELD 476 TAN+PQS TGM+LFLS LDIT RRDP N +P IN+LD Sbjct: 556 TANSPQSLLTGMNLFLSHLDITFRRDPTNFRPRINKLD 593