BLASTX nr result
ID: Papaver25_contig00038896
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00038896 (412 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004301076.1| PREDICTED: histone deacetylase 15-like [Frag... 57 3e-06 >ref|XP_004301076.1| PREDICTED: histone deacetylase 15-like [Fragaria vesca subsp. vesca] Length = 589 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/57 (52%), Positives = 41/57 (71%), Gaps = 1/57 (1%) Frame = -1 Query: 409 YNLRSISASAKAVVEVLLGGDPGGD-RKLEPSISGIETIREVLAIQSRFWKLDCSVF 242 YNLRSIS+SA +V++VLLG PG + PS SG++T+ EVL IQS++W + S F Sbjct: 479 YNLRSISSSATSVIKVLLGESPGCEFDNASPSRSGLQTVLEVLKIQSKYWPVLASNF 535