BLASTX nr result
ID: Papaver25_contig00038758
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00038758 (527 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004302221.1| PREDICTED: E3 ubiquitin-protein ligase RKP-l... 47 4e-06 >ref|XP_004302221.1| PREDICTED: E3 ubiquitin-protein ligase RKP-like [Fragaria vesca subsp. vesca] Length = 1275 Score = 46.6 bits (109), Expect(2) = 4e-06 Identities = 29/54 (53%), Positives = 34/54 (62%) Frame = +1 Query: 133 RQAMAYFI*MYLLGHFVATLINHPRISSTDLRGLLLQSFLVFVIQYKDYLVASE 294 +Q +A FI FV T N PRISS DLR LLLQS V ++QYK+YL A E Sbjct: 897 KQGLASFI------TFVVTHFNDPRISSADLRDLLLQSISV-LVQYKEYLAAFE 943 Score = 29.6 bits (65), Expect(2) = 4e-06 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +2 Query: 353 ILVRLCKGLGFALSRFRIYDSYFPIVYQKI 442 IL+RLCKG GF S+ S I++QK+ Sbjct: 971 ILLRLCKGSGFGSSKHGESSSSSSIIFQKL 1000