BLASTX nr result
ID: Papaver25_contig00038757
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00038757 (410 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB68685.1| hypothetical protein L484_024700 [Morus notabilis] 55 8e-06 >gb|EXB68685.1| hypothetical protein L484_024700 [Morus notabilis] Length = 341 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/72 (34%), Positives = 45/72 (62%), Gaps = 2/72 (2%) Frame = -1 Query: 359 QKKLDRNKQSYSSEELKVLRFESSYQQPQIWREIYTGLGPVVAKQLDQLAEARKNGNNA- 183 +KK + K YS E ++ LRF + +Q ++W++++ GLGP+V K+ D L +++ NN Sbjct: 198 KKKKEEGKMRYSREVMEALRFVNIVEQRRMWKDVHIGLGPLVGKEYDFLLSSKQQNNNIQ 257 Query: 182 -ITNQQQQHRQH 150 I Q Q+++ H Sbjct: 258 FIFPQAQENKNH 269