BLASTX nr result
ID: Papaver25_contig00038365
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00038365 (594 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_200219.1| homogentisate 1,2-dioxygenase [Arabidopsis thal... 73 5e-11 ref|XP_006401630.1| hypothetical protein EUTSA_v100136911mg, par... 73 5e-11 ref|XP_006280403.1| hypothetical protein CARUB_v10026329mg [Caps... 73 5e-11 gb|AAD00360.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana] 73 5e-11 gb|AAM65958.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana] 73 5e-11 ref|XP_002864301.1| homogentisate 1,2-dioxygenase [Arabidopsis l... 73 5e-11 gb|EYU44990.1| hypothetical protein MIMGU_mgv1a006018mg [Mimulus... 73 7e-11 ref|XP_007213873.1| hypothetical protein PRUPE_ppa005219mg [Prun... 73 7e-11 ref|XP_004251883.1| PREDICTED: LOW QUALITY PROTEIN: homogentisat... 73 7e-11 ref|XP_004137214.1| PREDICTED: homogentisate 1,2-dioxygenase-lik... 73 7e-11 gb|AAF73132.1|AF149017_1 homogentisate 1,2-dioxygenase [Solanum ... 73 7e-11 ref|XP_002518387.1| homogentisate 1,2-dioxygenase, putative [Ric... 73 7e-11 ref|XP_002298900.1| hypothetical protein POPTR_0001s38310g [Popu... 73 7e-11 ref|XP_002285298.1| PREDICTED: homogentisate 1,2-dioxygenase [Vi... 73 7e-11 gb|EXB75014.1| Homogentisate 1,2-dioxygenase [Morus notabilis] 72 9e-11 dbj|BAO57290.1| homogentisate 1,2-dioxygenase [Ipomoea nil] 72 1e-10 gb|EXC55248.1| Homogentisate 1,2-dioxygenase [Morus notabilis] 72 1e-10 gb|ABR16047.1| unknown [Picea sitchensis] 72 1e-10 ref|XP_006858313.1| hypothetical protein AMTR_s00064p00100410 [A... 72 2e-10 ref|XP_004510037.1| PREDICTED: homogentisate 1,2-dioxygenase-lik... 72 2e-10 >ref|NP_200219.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana] gi|30696407|ref|NP_851187.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana] gi|13432134|sp|Q9ZRA2.2|HGD_ARATH RecName: Full=Homogentisate 1,2-dioxygenase; AltName: Full=Homogentisate oxygenase; AltName: Full=Homogentisic acid oxidase; AltName: Full=Homogentisicase gi|7108615|gb|AAF36499.1|AF130845_1 homogentisate 1,2-dioxygenase [Arabidopsis thaliana] gi|8809579|dbj|BAA97130.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana] gi|22655252|gb|AAM98216.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana] gi|33942055|gb|AAQ55280.1| At5g54080 [Arabidopsis thaliana] gi|332009064|gb|AED96447.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana] gi|332009065|gb|AED96448.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana] Length = 461 Score = 73.2 bits (178), Expect = 5e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -2 Query: 416 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 291 +L+FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 318 LLDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGAYEAK 359 >ref|XP_006401630.1| hypothetical protein EUTSA_v100136911mg, partial [Eutrema salsugineum] gi|557102720|gb|ESQ43083.1| hypothetical protein EUTSA_v100136911mg, partial [Eutrema salsugineum] Length = 179 Score = 73.2 bits (178), Expect = 5e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -2 Query: 416 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 291 +L+FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 36 LLDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGAYEAK 77 >ref|XP_006280403.1| hypothetical protein CARUB_v10026329mg [Capsella rubella] gi|482549107|gb|EOA13301.1| hypothetical protein CARUB_v10026329mg [Capsella rubella] Length = 476 Score = 73.2 bits (178), Expect = 5e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -2 Query: 416 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 291 +L+FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 333 LLDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGAYEAK 374 >gb|AAD00360.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana] Length = 461 Score = 73.2 bits (178), Expect = 5e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -2 Query: 416 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 291 +L+FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 318 LLDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGAYEAK 359 >gb|AAM65958.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana] Length = 461 Score = 73.2 bits (178), Expect = 5e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -2 Query: 416 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 291 +L+FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 318 LLDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGAYEAK 359 >ref|XP_002864301.1| homogentisate 1,2-dioxygenase [Arabidopsis lyrata subsp. lyrata] gi|297310136|gb|EFH40560.1| homogentisate 1,2-dioxygenase [Arabidopsis lyrata subsp. lyrata] Length = 461 Score = 73.2 bits (178), Expect = 5e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -2 Query: 416 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 291 +L+FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 318 LLDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGAYEAK 359 >gb|EYU44990.1| hypothetical protein MIMGU_mgv1a006018mg [Mimulus guttatus] Length = 461 Score = 72.8 bits (177), Expect = 7e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -2 Query: 416 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 291 +L+FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 323 LLDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGGYEAK 364 >ref|XP_007213873.1| hypothetical protein PRUPE_ppa005219mg [Prunus persica] gi|462409738|gb|EMJ15072.1| hypothetical protein PRUPE_ppa005219mg [Prunus persica] Length = 472 Score = 72.8 bits (177), Expect = 7e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -2 Query: 416 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 291 +L+FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 331 LLDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGGYEAK 372 >ref|XP_004251883.1| PREDICTED: LOW QUALITY PROTEIN: homogentisate 1,2-dioxygenase [Solanum lycopersicum] Length = 480 Score = 72.8 bits (177), Expect = 7e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -2 Query: 416 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 291 +L+FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 321 LLDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGGYEAK 362 >ref|XP_004137214.1| PREDICTED: homogentisate 1,2-dioxygenase-like [Cucumis sativus] gi|449524824|ref|XP_004169421.1| PREDICTED: homogentisate 1,2-dioxygenase-like [Cucumis sativus] Length = 471 Score = 72.8 bits (177), Expect = 7e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -2 Query: 416 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 291 +L+FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 325 LLDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGGYEAK 366 >gb|AAF73132.1|AF149017_1 homogentisate 1,2-dioxygenase [Solanum lycopersicum] Length = 477 Score = 72.8 bits (177), Expect = 7e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -2 Query: 416 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 291 +L+FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 318 LLDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGGYEAK 359 >ref|XP_002518387.1| homogentisate 1,2-dioxygenase, putative [Ricinus communis] gi|223542482|gb|EEF44023.1| homogentisate 1,2-dioxygenase, putative [Ricinus communis] Length = 457 Score = 72.8 bits (177), Expect = 7e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -2 Query: 416 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 291 +L+FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 324 LLDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGGYEAK 365 >ref|XP_002298900.1| hypothetical protein POPTR_0001s38310g [Populus trichocarpa] gi|222846158|gb|EEE83705.1| hypothetical protein POPTR_0001s38310g [Populus trichocarpa] Length = 464 Score = 72.8 bits (177), Expect = 7e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -2 Query: 416 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 291 +L+FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 330 LLDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGGYEAK 371 >ref|XP_002285298.1| PREDICTED: homogentisate 1,2-dioxygenase [Vitis vinifera] gi|302142933|emb|CBI20228.3| unnamed protein product [Vitis vinifera] Length = 463 Score = 72.8 bits (177), Expect = 7e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -2 Query: 416 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 291 +L+FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 325 LLDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGGYEAK 366 >gb|EXB75014.1| Homogentisate 1,2-dioxygenase [Morus notabilis] Length = 460 Score = 72.4 bits (176), Expect = 9e-11 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -2 Query: 416 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 291 +L+FV+FPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 317 LLDFVVFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGGYEAK 358 >dbj|BAO57290.1| homogentisate 1,2-dioxygenase [Ipomoea nil] Length = 464 Score = 72.0 bits (175), Expect = 1e-10 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -2 Query: 416 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 291 +++FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 325 LMDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGGYEAK 366 >gb|EXC55248.1| Homogentisate 1,2-dioxygenase [Morus notabilis] Length = 359 Score = 72.0 bits (175), Expect = 1e-10 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -2 Query: 416 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEV 294 +L+FV+FPP WL+ HTFRPPY+H NCMSEFM LIYG +EV Sbjct: 317 LLDFVVFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGGYEV 357 >gb|ABR16047.1| unknown [Picea sitchensis] Length = 463 Score = 72.0 bits (175), Expect = 1e-10 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -2 Query: 416 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 291 +++FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 328 VVDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGNYEAK 369 >ref|XP_006858313.1| hypothetical protein AMTR_s00064p00100410 [Amborella trichopoda] gi|548862420|gb|ERN19780.1| hypothetical protein AMTR_s00064p00100410 [Amborella trichopoda] Length = 471 Score = 71.6 bits (174), Expect = 2e-10 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -2 Query: 416 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 291 +++FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 319 LVDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGGYEAK 360 >ref|XP_004510037.1| PREDICTED: homogentisate 1,2-dioxygenase-like [Cicer arietinum] Length = 455 Score = 71.6 bits (174), Expect = 2e-10 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -2 Query: 416 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 291 +L+FVIFPP WL+ HTFRPPY+H NCMSEFM LI+G +E K Sbjct: 317 LLDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIHGNYEAK 358