BLASTX nr result
ID: Papaver25_contig00038134
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00038134 (457 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002448336.1| hypothetical protein SORBIDRAFT_06g025380 [S... 59 7e-07 ref|NP_001150603.1| cyclin B2 [Zea mays] gi|195640504|gb|ACG3972... 57 3e-06 gb|ACN27152.1| unknown [Zea mays] gi|413919273|gb|AFW59205.1| cy... 57 4e-06 ref|NP_001140693.1| cyclin superfamily protein, putative [Zea ma... 57 4e-06 gb|EMT08838.1| Cyclin-B2-2 [Aegilops tauschii] 56 6e-06 gb|EMS50247.1| Cyclin-B2-2 [Triticum urartu] 56 6e-06 ref|XP_003563246.1| PREDICTED: cyclin-B2-2-like [Brachypodium di... 55 8e-06 >ref|XP_002448336.1| hypothetical protein SORBIDRAFT_06g025380 [Sorghum bicolor] gi|241939519|gb|EES12664.1| hypothetical protein SORBIDRAFT_06g025380 [Sorghum bicolor] Length = 432 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 3 TGKLTGVHRKYSMYKFGCAAKSQPAQFLLDT 95 TGKLTGVHRKYS YKFGCAAK+ PAQFLL++ Sbjct: 392 TGKLTGVHRKYSTYKFGCAAKTLPAQFLLES 422 >ref|NP_001150603.1| cyclin B2 [Zea mays] gi|195640504|gb|ACG39720.1| cyclin B2 [Zea mays] Length = 426 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +3 Query: 3 TGKLTGVHRKYSMYKFGCAAKSQPAQFLLDT 95 TGKLTGVHRKYS YKFGCAAK PAQF+L++ Sbjct: 385 TGKLTGVHRKYSTYKFGCAAKIVPAQFMLES 415 >gb|ACN27152.1| unknown [Zea mays] gi|413919273|gb|AFW59205.1| cyclin superfamily protein, putative [Zea mays] Length = 109 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 3 TGKLTGVHRKYSMYKFGCAAKSQPAQFLLD 92 TGKLTGVHRKYS YKFGCAAK PAQF+L+ Sbjct: 68 TGKLTGVHRKYSTYKFGCAAKILPAQFMLE 97 >ref|NP_001140693.1| cyclin superfamily protein, putative [Zea mays] gi|194700606|gb|ACF84387.1| unknown [Zea mays] gi|224031299|gb|ACN34725.1| unknown [Zea mays] gi|413919272|gb|AFW59204.1| cyclin superfamily protein, putative [Zea mays] Length = 426 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 3 TGKLTGVHRKYSMYKFGCAAKSQPAQFLLD 92 TGKLTGVHRKYS YKFGCAAK PAQF+L+ Sbjct: 385 TGKLTGVHRKYSTYKFGCAAKILPAQFMLE 414 >gb|EMT08838.1| Cyclin-B2-2 [Aegilops tauschii] Length = 449 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +3 Query: 6 GKLTGVHRKYSMYKFGCAAKSQPAQFLLD 92 GKLTGVHRKYS +K+GCAAKS+PA FLLD Sbjct: 417 GKLTGVHRKYSTFKYGCAAKSEPAAFLLD 445 >gb|EMS50247.1| Cyclin-B2-2 [Triticum urartu] Length = 419 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +3 Query: 6 GKLTGVHRKYSMYKFGCAAKSQPAQFLLD 92 GKLTGVHRKYS +K+GCAAKS+PA FLLD Sbjct: 387 GKLTGVHRKYSTFKYGCAAKSEPAAFLLD 415 >ref|XP_003563246.1| PREDICTED: cyclin-B2-2-like [Brachypodium distachyon] Length = 419 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +3 Query: 6 GKLTGVHRKYSMYKFGCAAKSQPAQFLLD 92 GKLTGVHRKYS +K+GCAAKS+PA FLLD Sbjct: 390 GKLTGVHRKYSTFKYGCAAKSEPAGFLLD 418