BLASTX nr result
ID: Papaver25_contig00038036
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00038036 (694 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003564979.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 56 1e-05 >ref|XP_003564979.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Brachypodium distachyon] Length = 229 Score = 56.2 bits (134), Expect = 1e-05 Identities = 29/82 (35%), Positives = 40/82 (48%) Frame = -1 Query: 295 SLQTSQQRAPPSGYRLSVTEGSSECPICWEALQHQGDTGGNDCNSSCSEPCIINKCKHMF 116 S ++ +A SGY ++ TE CP C E + + P II KC H F Sbjct: 155 STKSLSAKAYNSGYAVATTEDEDVCPTCLE-------------DYTPENPKIITKCSHHF 201 Query: 115 HVSCIYQWMISGHSKQTTCPVC 50 H+SCIY+WM + TCP+C Sbjct: 202 HLSCIYEWM----ERSDTCPMC 219