BLASTX nr result
ID: Papaver25_contig00037760
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00037760 (767 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006826729.1| hypothetical protein AMTR_s00136p00027550 [A... 57 6e-06 >ref|XP_006826729.1| hypothetical protein AMTR_s00136p00027550 [Amborella trichopoda] gi|548831149|gb|ERM93966.1| hypothetical protein AMTR_s00136p00027550 [Amborella trichopoda] Length = 1275 Score = 57.4 bits (137), Expect = 6e-06 Identities = 31/52 (59%), Positives = 36/52 (69%) Frame = -2 Query: 556 IFEWTGDAIITKGNHHSPRMNPGP*DEHKLYL*IDGPTESSVHKEIAELGRV 401 I EWTG AI T+G ++ P PGP E KLYL I+GPTESSV K AE+ RV Sbjct: 1202 ISEWTGAAITTRGQYYPPGKIPGP-GERKLYLFIEGPTESSVKKAKAEVKRV 1252