BLASTX nr result
ID: Papaver25_contig00037413
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00037413 (659 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517253.1| conserved hypothetical protein [Ricinus comm... 58 2e-06 >ref|XP_002517253.1| conserved hypothetical protein [Ricinus communis] gi|223543624|gb|EEF45153.1| conserved hypothetical protein [Ricinus communis] Length = 416 Score = 58.2 bits (139), Expect = 2e-06 Identities = 34/71 (47%), Positives = 47/71 (66%), Gaps = 3/71 (4%) Frame = -2 Query: 205 VATFNRSLSGHYSRKGLSFGSPRSPRVGG---HRKTWVSRSFHILVGCSLLITFVLAMGC 35 + TFNRS S +++K L+ GSPRS G +R + +S F +LV L+TF +A+G Sbjct: 1 MTTFNRSKS--FNQKVLNVGSPRSLSFGSPRVNRSSLISHWFTVLVVIGSLLTFFIAIGG 58 Query: 34 GYLYVLPSLTQ 2 GY+YVLPSLTQ Sbjct: 59 GYIYVLPSLTQ 69