BLASTX nr result
ID: Papaver25_contig00037351
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00037351 (866 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006280256.1| hypothetical protein CARUB_v10026172mg [Caps... 37 3e-06 ref|XP_006418882.1| hypothetical protein EUTSA_v10002472mg [Eutr... 43 6e-06 >ref|XP_006280256.1| hypothetical protein CARUB_v10026172mg [Capsella rubella] gi|482548960|gb|EOA13154.1| hypothetical protein CARUB_v10026172mg [Capsella rubella] Length = 560 Score = 37.4 bits (85), Expect(3) = 3e-06 Identities = 35/102 (34%), Positives = 47/102 (46%), Gaps = 8/102 (7%) Frame = -2 Query: 595 WEHFSVPGDRCQWRHCWCRRKRA*ISNSV*KLS-----SQSTPRDSHCRRSTLVVSFSVS 431 W+ S D WR+ + + +R S + K S S D R S +VS Sbjct: 205 WKGSSRHTDTKPWRNYYLQNQR---SYPIKKRKYYDHISDSITDDYRLRTKMHRGSRTVS 261 Query: 430 CLTSEVLFFTNPTT---LGICSFVVPELFHEIPETTTVGSLK 314 + + F + + L I SF VPELF EIPE+ TVGSLK Sbjct: 262 SMKGQGASFVSSNSHVKLRIKSFRVPELFIEIPESATVGSLK 303 Score = 31.2 bits (69), Expect(3) = 3e-06 Identities = 17/35 (48%), Positives = 21/35 (60%), Gaps = 4/35 (11%) Frame = -1 Query: 314 VVKGNKVWDDSKTLLQTGI----RHIDKFYTGAEP 222 +V+G KV DD+KTL QTGI H+D EP Sbjct: 323 MVQGKKVRDDNKTLHQTGISQDNNHLDSLDFSLEP 357 Score = 28.9 bits (63), Expect(3) = 3e-06 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -3 Query: 765 RQAPLIGDHRIRKLLAYKH 709 R P IGD RIRK+LA +H Sbjct: 186 RSVPRIGDRRIRKILASRH 204 >ref|XP_006418882.1| hypothetical protein EUTSA_v10002472mg [Eutrema salsugineum] gi|312282743|dbj|BAJ34237.1| unnamed protein product [Thellungiella halophila] gi|557096810|gb|ESQ37318.1| hypothetical protein EUTSA_v10002472mg [Eutrema salsugineum] Length = 543 Score = 42.7 bits (99), Expect(2) = 6e-06 Identities = 30/64 (46%), Positives = 34/64 (53%), Gaps = 3/64 (4%) Frame = -2 Query: 496 SQSTPRDSHCRRSTLVVSFSVSCLTSEVLFFTNP---TTLGICSFVVPELFHEIPETTTV 326 S S D H + T S +VS + S F + L I SF VPELF EIPET TV Sbjct: 246 SDSNSDDYHLKAKTHKGSRTVSSMKSRNASFVSRDHHVRLRIKSFRVPELFIEIPETATV 305 Query: 325 GSLK 314 GSLK Sbjct: 306 GSLK 309 Score = 34.7 bits (78), Expect(2) = 6e-06 Identities = 19/35 (54%), Positives = 22/35 (62%), Gaps = 4/35 (11%) Frame = -1 Query: 314 VVKGNKVWDDSKTLLQTGI----RHIDKFYTGAEP 222 +V+G KV DDSKTLLQTGI H+D EP Sbjct: 329 MVQGKKVRDDSKTLLQTGISEENTHLDSLGFSLEP 363