BLASTX nr result
ID: Papaver25_contig00037281
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00037281 (840 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276403.1| PREDICTED: uncharacterized protein LOC100243... 58 5e-06 >ref|XP_002276403.1| PREDICTED: uncharacterized protein LOC100243222 [Vitis vinifera] Length = 519 Score = 57.8 bits (138), Expect = 5e-06 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +3 Query: 3 DPHSIAERLSRERIAERMKALQELVPSFSKVMPSTL 110 DPHSIAERL RERIAERMKALQELVP+ +KV+ TL Sbjct: 294 DPHSIAERLRRERIAERMKALQELVPNANKVIHPTL 329