BLASTX nr result
ID: Papaver25_contig00036978
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00036978 (751 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007216336.1| hypothetical protein PRUPE_ppa020142mg, part... 57 7e-06 >ref|XP_007216336.1| hypothetical protein PRUPE_ppa020142mg, partial [Prunus persica] gi|462412486|gb|EMJ17535.1| hypothetical protein PRUPE_ppa020142mg, partial [Prunus persica] Length = 495 Score = 57.0 bits (136), Expect = 7e-06 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = +2 Query: 92 QVPAGKDKEAIYNMLPYL*VGYVEDPSEMQSVIWSQVPI 208 QV GK+KE +++MLPYL +GYV DPSEMQSVI SQ PI Sbjct: 385 QVNVGKEKETVFDMLPYLRLGYVSDPSEMQSVISSQGPI 423