BLASTX nr result
ID: Papaver25_contig00036401
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00036401 (516 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007161625.1| hypothetical protein PHAVU_001G0851000g, par... 56 6e-06 >ref|XP_007161625.1| hypothetical protein PHAVU_001G0851000g, partial [Phaseolus vulgaris] gi|561035089|gb|ESW33619.1| hypothetical protein PHAVU_001G0851000g, partial [Phaseolus vulgaris] Length = 84 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/58 (48%), Positives = 33/58 (56%) Frame = -3 Query: 310 DPTW*HGTEVKGPVRNGRPAVYVHCKFCEKTVTGGISRFKSHLSHTHKGFGACHRVPD 137 DP W H + G RN V CK+CEK +TGGI R K HL+ T K GAC VP+ Sbjct: 13 DPAWNHCISIDGKSRN------VKCKYCEKILTGGIYRLKHHLACTSKDVGACLVVPE 64