BLASTX nr result
ID: Papaver25_contig00036186
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00036186 (649 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABR16047.1| unknown [Picea sitchensis] 68 2e-09 ref|NP_200219.1| homogentisate 1,2-dioxygenase [Arabidopsis thal... 68 3e-09 ref|XP_006401630.1| hypothetical protein EUTSA_v100136911mg, par... 68 3e-09 ref|XP_006280403.1| hypothetical protein CARUB_v10026329mg [Caps... 68 3e-09 gb|AAD00360.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana] 68 3e-09 gb|AAM65958.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana] 68 3e-09 ref|XP_002864301.1| homogentisate 1,2-dioxygenase [Arabidopsis l... 68 3e-09 gb|EYU44990.1| hypothetical protein MIMGU_mgv1a006018mg [Mimulus... 67 4e-09 dbj|BAO57290.1| homogentisate 1,2-dioxygenase [Ipomoea nil] 67 4e-09 gb|EXB75014.1| Homogentisate 1,2-dioxygenase [Morus notabilis] 67 4e-09 gb|ESO93280.1| hypothetical protein LOTGIDRAFT_189917 [Lottia gi... 67 4e-09 ref|XP_006858313.1| hypothetical protein AMTR_s00064p00100410 [A... 67 4e-09 ref|XP_007213873.1| hypothetical protein PRUPE_ppa005219mg [Prun... 67 4e-09 ref|XP_004251883.1| PREDICTED: LOW QUALITY PROTEIN: homogentisat... 67 4e-09 ref|XP_004137214.1| PREDICTED: homogentisate 1,2-dioxygenase-lik... 67 4e-09 gb|AAF73132.1|AF149017_1 homogentisate 1,2-dioxygenase [Solanum ... 67 4e-09 ref|XP_002518387.1| homogentisate 1,2-dioxygenase, putative [Ric... 67 4e-09 ref|XP_002298900.1| hypothetical protein POPTR_0001s38310g [Popu... 67 4e-09 ref|XP_002285298.1| PREDICTED: homogentisate 1,2-dioxygenase [Vi... 67 4e-09 gb|EXC55248.1| Homogentisate 1,2-dioxygenase [Morus notabilis] 67 5e-09 >gb|ABR16047.1| unknown [Picea sitchensis] Length = 463 Score = 68.2 bits (165), Expect = 2e-09 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +2 Query: 527 NFVSFSPGWLIVGHKFRPPYYHCNCMSEFMGLIYGKHEVK 646 +FV F P WL+ H FRPPYYH NCMSEFMGLIYG +E K Sbjct: 330 DFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGNYEAK 369 >ref|NP_200219.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana] gi|30696407|ref|NP_851187.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana] gi|13432134|sp|Q9ZRA2.2|HGD_ARATH RecName: Full=Homogentisate 1,2-dioxygenase; AltName: Full=Homogentisate oxygenase; AltName: Full=Homogentisic acid oxidase; AltName: Full=Homogentisicase gi|7108615|gb|AAF36499.1|AF130845_1 homogentisate 1,2-dioxygenase [Arabidopsis thaliana] gi|8809579|dbj|BAA97130.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana] gi|22655252|gb|AAM98216.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana] gi|33942055|gb|AAQ55280.1| At5g54080 [Arabidopsis thaliana] gi|332009064|gb|AED96447.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana] gi|332009065|gb|AED96448.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana] Length = 461 Score = 67.8 bits (164), Expect = 3e-09 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +2 Query: 527 NFVSFSPGWLIVGHKFRPPYYHCNCMSEFMGLIYGKHEVK 646 +FV F P WL+ H FRPPYYH NCMSEFMGLIYG +E K Sbjct: 320 DFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGAYEAK 359 >ref|XP_006401630.1| hypothetical protein EUTSA_v100136911mg, partial [Eutrema salsugineum] gi|557102720|gb|ESQ43083.1| hypothetical protein EUTSA_v100136911mg, partial [Eutrema salsugineum] Length = 179 Score = 67.8 bits (164), Expect = 3e-09 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +2 Query: 527 NFVSFSPGWLIVGHKFRPPYYHCNCMSEFMGLIYGKHEVK 646 +FV F P WL+ H FRPPYYH NCMSEFMGLIYG +E K Sbjct: 38 DFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGAYEAK 77 >ref|XP_006280403.1| hypothetical protein CARUB_v10026329mg [Capsella rubella] gi|482549107|gb|EOA13301.1| hypothetical protein CARUB_v10026329mg [Capsella rubella] Length = 476 Score = 67.8 bits (164), Expect = 3e-09 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +2 Query: 527 NFVSFSPGWLIVGHKFRPPYYHCNCMSEFMGLIYGKHEVK 646 +FV F P WL+ H FRPPYYH NCMSEFMGLIYG +E K Sbjct: 335 DFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGAYEAK 374 >gb|AAD00360.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana] Length = 461 Score = 67.8 bits (164), Expect = 3e-09 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +2 Query: 527 NFVSFSPGWLIVGHKFRPPYYHCNCMSEFMGLIYGKHEVK 646 +FV F P WL+ H FRPPYYH NCMSEFMGLIYG +E K Sbjct: 320 DFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGAYEAK 359 >gb|AAM65958.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana] Length = 461 Score = 67.8 bits (164), Expect = 3e-09 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +2 Query: 527 NFVSFSPGWLIVGHKFRPPYYHCNCMSEFMGLIYGKHEVK 646 +FV F P WL+ H FRPPYYH NCMSEFMGLIYG +E K Sbjct: 320 DFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGAYEAK 359 >ref|XP_002864301.1| homogentisate 1,2-dioxygenase [Arabidopsis lyrata subsp. lyrata] gi|297310136|gb|EFH40560.1| homogentisate 1,2-dioxygenase [Arabidopsis lyrata subsp. lyrata] Length = 461 Score = 67.8 bits (164), Expect = 3e-09 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +2 Query: 527 NFVSFSPGWLIVGHKFRPPYYHCNCMSEFMGLIYGKHEVK 646 +FV F P WL+ H FRPPYYH NCMSEFMGLIYG +E K Sbjct: 320 DFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGAYEAK 359 >gb|EYU44990.1| hypothetical protein MIMGU_mgv1a006018mg [Mimulus guttatus] Length = 461 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +2 Query: 527 NFVSFSPGWLIVGHKFRPPYYHCNCMSEFMGLIYGKHEVK 646 +FV F P WL+ H FRPPYYH NCMSEFMGLIYG +E K Sbjct: 325 DFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGGYEAK 364 >dbj|BAO57290.1| homogentisate 1,2-dioxygenase [Ipomoea nil] Length = 464 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +2 Query: 527 NFVSFSPGWLIVGHKFRPPYYHCNCMSEFMGLIYGKHEVK 646 +FV F P WL+ H FRPPYYH NCMSEFMGLIYG +E K Sbjct: 327 DFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGGYEAK 366 >gb|EXB75014.1| Homogentisate 1,2-dioxygenase [Morus notabilis] Length = 460 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +2 Query: 527 NFVSFSPGWLIVGHKFRPPYYHCNCMSEFMGLIYGKHEVK 646 +FV F P WL+ H FRPPYYH NCMSEFMGLIYG +E K Sbjct: 319 DFVVFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGGYEAK 358 >gb|ESO93280.1| hypothetical protein LOTGIDRAFT_189917 [Lottia gigantea] Length = 450 Score = 67.4 bits (163), Expect = 4e-09 Identities = 35/66 (53%), Positives = 41/66 (62%), Gaps = 5/66 (7%) Frame = +2 Query: 464 DPFIFK-----KARLGVVMIFKVRNANFVSFSPGWLIVGHKFRPPYYHCNCMSEFMGLIY 628 DP IF A+ GV + A+FV F P W + H FRPPYYH NCMSEFMGLI+ Sbjct: 292 DPSIFTVLTCPSAKPGVAI------ADFVIFPPRWSVQEHSFRPPYYHRNCMSEFMGLIH 345 Query: 629 GKHEVK 646 GK+E K Sbjct: 346 GKYEAK 351 >ref|XP_006858313.1| hypothetical protein AMTR_s00064p00100410 [Amborella trichopoda] gi|548862420|gb|ERN19780.1| hypothetical protein AMTR_s00064p00100410 [Amborella trichopoda] Length = 471 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +2 Query: 527 NFVSFSPGWLIVGHKFRPPYYHCNCMSEFMGLIYGKHEVK 646 +FV F P WL+ H FRPPYYH NCMSEFMGLIYG +E K Sbjct: 321 DFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGGYEAK 360 >ref|XP_007213873.1| hypothetical protein PRUPE_ppa005219mg [Prunus persica] gi|462409738|gb|EMJ15072.1| hypothetical protein PRUPE_ppa005219mg [Prunus persica] Length = 472 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +2 Query: 527 NFVSFSPGWLIVGHKFRPPYYHCNCMSEFMGLIYGKHEVK 646 +FV F P WL+ H FRPPYYH NCMSEFMGLIYG +E K Sbjct: 333 DFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGGYEAK 372 >ref|XP_004251883.1| PREDICTED: LOW QUALITY PROTEIN: homogentisate 1,2-dioxygenase [Solanum lycopersicum] Length = 480 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +2 Query: 527 NFVSFSPGWLIVGHKFRPPYYHCNCMSEFMGLIYGKHEVK 646 +FV F P WL+ H FRPPYYH NCMSEFMGLIYG +E K Sbjct: 323 DFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGGYEAK 362 >ref|XP_004137214.1| PREDICTED: homogentisate 1,2-dioxygenase-like [Cucumis sativus] gi|449524824|ref|XP_004169421.1| PREDICTED: homogentisate 1,2-dioxygenase-like [Cucumis sativus] Length = 471 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +2 Query: 527 NFVSFSPGWLIVGHKFRPPYYHCNCMSEFMGLIYGKHEVK 646 +FV F P WL+ H FRPPYYH NCMSEFMGLIYG +E K Sbjct: 327 DFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGGYEAK 366 >gb|AAF73132.1|AF149017_1 homogentisate 1,2-dioxygenase [Solanum lycopersicum] Length = 477 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +2 Query: 527 NFVSFSPGWLIVGHKFRPPYYHCNCMSEFMGLIYGKHEVK 646 +FV F P WL+ H FRPPYYH NCMSEFMGLIYG +E K Sbjct: 320 DFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGGYEAK 359 >ref|XP_002518387.1| homogentisate 1,2-dioxygenase, putative [Ricinus communis] gi|223542482|gb|EEF44023.1| homogentisate 1,2-dioxygenase, putative [Ricinus communis] Length = 457 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +2 Query: 527 NFVSFSPGWLIVGHKFRPPYYHCNCMSEFMGLIYGKHEVK 646 +FV F P WL+ H FRPPYYH NCMSEFMGLIYG +E K Sbjct: 326 DFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGGYEAK 365 >ref|XP_002298900.1| hypothetical protein POPTR_0001s38310g [Populus trichocarpa] gi|222846158|gb|EEE83705.1| hypothetical protein POPTR_0001s38310g [Populus trichocarpa] Length = 464 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +2 Query: 527 NFVSFSPGWLIVGHKFRPPYYHCNCMSEFMGLIYGKHEVK 646 +FV F P WL+ H FRPPYYH NCMSEFMGLIYG +E K Sbjct: 332 DFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGGYEAK 371 >ref|XP_002285298.1| PREDICTED: homogentisate 1,2-dioxygenase [Vitis vinifera] gi|302142933|emb|CBI20228.3| unnamed protein product [Vitis vinifera] Length = 463 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +2 Query: 527 NFVSFSPGWLIVGHKFRPPYYHCNCMSEFMGLIYGKHEVK 646 +FV F P WL+ H FRPPYYH NCMSEFMGLIYG +E K Sbjct: 327 DFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGGYEAK 366 >gb|EXC55248.1| Homogentisate 1,2-dioxygenase [Morus notabilis] Length = 359 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +2 Query: 527 NFVSFSPGWLIVGHKFRPPYYHCNCMSEFMGLIYGKHEV 643 +FV F P WL+ H FRPPYYH NCMSEFMGLIYG +EV Sbjct: 319 DFVVFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGGYEV 357