BLASTX nr result
ID: Papaver25_contig00035923
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00035923 (532 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003592894.1| hypothetical protein MTR_2g005460 [Medicago ... 57 4e-06 >ref|XP_003592894.1| hypothetical protein MTR_2g005460 [Medicago truncatula] gi|92893902|gb|ABE91952.1| Zinc finger, CCHC-type [Medicago truncatula] gi|355481942|gb|AES63145.1| hypothetical protein MTR_2g005460 [Medicago truncatula] Length = 504 Score = 56.6 bits (135), Expect = 4e-06 Identities = 22/54 (40%), Positives = 36/54 (66%) Frame = +2 Query: 338 IPKIILSPETWQRICTPLAQCLIGKVMGRTVGYKFLKDRTFSLWKPCGDLQILD 499 +PKI + P+T+Q +CTP L+ K++G+++GY +KDR +WK G I+D Sbjct: 70 LPKIYIEPQTFQELCTPWKDALVVKLLGKSLGYNTMKDRLQKIWKLQGGFDIMD 123