BLASTX nr result
ID: Papaver25_contig00035674
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00035674 (489 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFG46439.1| hypothetical protein UMN_3380_01, partial [Pinus ... 70 2e-10 gb|AEW09310.1| hypothetical protein UMN_3380_01, partial [Pinus ... 70 2e-10 ref|XP_002514483.1| Caldesmon, putative [Ricinus communis] gi|22... 67 3e-09 ref|XP_004160889.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 65 7e-09 ref|XP_004148127.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 65 7e-09 ref|XP_006490247.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 64 2e-08 ref|XP_006421749.1| hypothetical protein CICLE_v10004843mg [Citr... 64 2e-08 ref|XP_002271499.1| PREDICTED: uncharacterized protein LOC100267... 64 2e-08 gb|AAG51009.1|AC069474_8 FKBP-type peptidyl-prolyl cis-trans iso... 64 3e-08 dbj|BAB03141.1| unnamed protein product [Arabidopsis thaliana] 64 3e-08 ref|NP_187840.7| FKBP-like peptidyl-prolyl cis-trans isomerase f... 64 3e-08 ref|XP_006478156.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 63 4e-08 ref|XP_006441495.1| hypothetical protein CICLE_v10019343mg [Citr... 63 4e-08 ref|XP_006851835.1| hypothetical protein AMTR_s00041p00068660 [A... 63 4e-08 ref|XP_007219679.1| hypothetical protein PRUPE_ppa025416mg [Prun... 63 4e-08 ref|XP_007038455.1| Fk506 binding protein 53, putative isoform 2... 62 6e-08 ref|XP_007038454.1| FK506-binding protein, putative isoform 1 [T... 62 6e-08 ref|XP_002989733.1| hypothetical protein SELMODRAFT_428238 [Sela... 62 6e-08 ref|XP_006339431.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 62 8e-08 ref|XP_004229814.1| PREDICTED: uncharacterized protein LOC101252... 62 8e-08 >gb|AFG46439.1| hypothetical protein UMN_3380_01, partial [Pinus taeda] gi|383131299|gb|AFG46440.1| hypothetical protein UMN_3380_01, partial [Pinus taeda] gi|383131302|gb|AFG46443.1| hypothetical protein UMN_3380_01, partial [Pinus taeda] gi|383131303|gb|AFG46444.1| hypothetical protein UMN_3380_01, partial [Pinus taeda] gi|383131304|gb|AFG46445.1| hypothetical protein UMN_3380_01, partial [Pinus taeda] gi|383131309|gb|AFG46450.1| hypothetical protein UMN_3380_01, partial [Pinus taeda] gi|383131310|gb|AFG46451.1| hypothetical protein UMN_3380_01, partial [Pinus taeda] gi|383131311|gb|AFG46452.1| hypothetical protein UMN_3380_01, partial [Pinus taeda] Length = 94 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/52 (61%), Positives = 39/52 (75%) Frame = -1 Query: 480 VLCRVGFGPSVILCSLTAGKNESCELDLDFDEDMEIIFSVDGPHSVHLTGYY 325 V C VG P V+LCSL G+ E+C L+L F+ED E++FSV GP SVHLTGYY Sbjct: 41 VQCNVGDRPGVLLCSLLPGRKETCSLNLMFNEDEEVVFSVLGPSSVHLTGYY 92 >gb|AEW09310.1| hypothetical protein UMN_3380_01, partial [Pinus radiata] gi|383131300|gb|AFG46441.1| hypothetical protein UMN_3380_01, partial [Pinus taeda] gi|383131301|gb|AFG46442.1| hypothetical protein UMN_3380_01, partial [Pinus taeda] gi|383131305|gb|AFG46446.1| hypothetical protein UMN_3380_01, partial [Pinus taeda] gi|383131306|gb|AFG46447.1| hypothetical protein UMN_3380_01, partial [Pinus taeda] gi|383131307|gb|AFG46448.1| hypothetical protein UMN_3380_01, partial [Pinus taeda] gi|383131308|gb|AFG46449.1| hypothetical protein UMN_3380_01, partial [Pinus taeda] gi|383131312|gb|AFG46453.1| hypothetical protein UMN_3380_01, partial [Pinus taeda] Length = 94 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/52 (61%), Positives = 39/52 (75%) Frame = -1 Query: 480 VLCRVGFGPSVILCSLTAGKNESCELDLDFDEDMEIIFSVDGPHSVHLTGYY 325 V C VG P V+LCSL G+ E+C L+L F+ED E++FSV GP SVHLTGYY Sbjct: 41 VQCNVGDRPGVLLCSLLPGRKETCSLNLIFNEDEEVVFSVLGPSSVHLTGYY 92 >ref|XP_002514483.1| Caldesmon, putative [Ricinus communis] gi|223546382|gb|EEF47883.1| Caldesmon, putative [Ricinus communis] Length = 584 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/52 (55%), Positives = 39/52 (75%) Frame = -1 Query: 480 VLCRVGFGPSVILCSLTAGKNESCELDLDFDEDMEIIFSVDGPHSVHLTGYY 325 V C +G V LCSL ++ESC+L+L+FDE ++++FSV GP SVHLTGYY Sbjct: 46 VQCNIGNKSPVFLCSLFPEQSESCQLNLEFDESVDVVFSVIGPRSVHLTGYY 97 >ref|XP_004160889.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP53-like [Cucumis sativus] Length = 471 Score = 65.5 bits (158), Expect = 7e-09 Identities = 33/67 (49%), Positives = 42/67 (62%), Gaps = 1/67 (1%) Frame = -1 Query: 489 RCNVLCRVGFGPSVILCSLTAGKNESCELDLDFDEDMEIIFSVDGPHSVHLTGYY-RDKR 313 R V C VG + LCSL K ESC LDL+F+ED I FSV GP S+HL+GY+ +++ Sbjct: 40 RSIVQCSVGNKSPIFLCSLIPNKIESCPLDLEFEEDESIAFSVSGPQSIHLSGYFVANEQ 99 Query: 312 KPSEDDY 292 DDY Sbjct: 100 HVIRDDY 106 >ref|XP_004148127.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP53-like [Cucumis sativus] Length = 507 Score = 65.5 bits (158), Expect = 7e-09 Identities = 33/67 (49%), Positives = 42/67 (62%), Gaps = 1/67 (1%) Frame = -1 Query: 489 RCNVLCRVGFGPSVILCSLTAGKNESCELDLDFDEDMEIIFSVDGPHSVHLTGYY-RDKR 313 R V C VG + LCSL K ESC LDL+F+ED I FSV GP S+HL+GY+ +++ Sbjct: 40 RSIVQCSVGNKSPIFLCSLIPNKIESCPLDLEFEEDESIAFSVSGPQSIHLSGYFVANEQ 99 Query: 312 KPSEDDY 292 DDY Sbjct: 100 HVIRDDY 106 >ref|XP_006490247.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP53-like [Citrus sinensis] Length = 489 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/50 (56%), Positives = 34/50 (68%) Frame = -1 Query: 474 CRVGFGPSVILCSLTAGKNESCELDLDFDEDMEIIFSVDGPHSVHLTGYY 325 C VG + LCSL KNESC L L+FDED ++FSV GP S+HL GY+ Sbjct: 45 CSVGDRSPIFLCSLLPNKNESCPLKLEFDEDDVVVFSVKGPQSIHLAGYF 94 >ref|XP_006421749.1| hypothetical protein CICLE_v10004843mg [Citrus clementina] gi|557523622|gb|ESR34989.1| hypothetical protein CICLE_v10004843mg [Citrus clementina] Length = 489 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/50 (56%), Positives = 34/50 (68%) Frame = -1 Query: 474 CRVGFGPSVILCSLTAGKNESCELDLDFDEDMEIIFSVDGPHSVHLTGYY 325 C VG + LCSL KNESC L L+FDED ++FSV GP S+HL GY+ Sbjct: 45 CSVGDRSPIFLCSLLPNKNESCPLKLEFDEDDVVVFSVKGPQSIHLAGYF 94 >ref|XP_002271499.1| PREDICTED: uncharacterized protein LOC100267010 [Vitis vinifera] gi|296086769|emb|CBI32918.3| unnamed protein product [Vitis vinifera] Length = 555 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/52 (59%), Positives = 35/52 (67%) Frame = -1 Query: 480 VLCRVGFGPSVILCSLTAGKNESCELDLDFDEDMEIIFSVDGPHSVHLTGYY 325 V C VG V+LC L K ESC L L+F+E E+IFSV GP SVHLTGYY Sbjct: 43 VQCNVGNKSPVLLCCLLPDKTESCTLSLEFEEVEEVIFSVIGPRSVHLTGYY 94 >gb|AAG51009.1|AC069474_8 FKBP-type peptidyl-prolyl cis-trans isomerase, putative; 96901-102074 [Arabidopsis thaliana] Length = 647 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/63 (47%), Positives = 44/63 (69%), Gaps = 3/63 (4%) Frame = -1 Query: 474 CRVGFGPSVILCSLTAGKNESCELDLDFDEDMEIIFSVDGPHSVHLTGYYRDKR---KPS 304 C VG ++LC LT K +SC+L+L+F+E E+IFSV GP SVHLTGY+ + +P+ Sbjct: 195 CNVGNKSPLLLCVLTPDKVDSCQLNLEFEETDEVIFSVIGPRSVHLTGYFLGRSTGFRPN 254 Query: 303 EDD 295 +D+ Sbjct: 255 DDE 257 >dbj|BAB03141.1| unnamed protein product [Arabidopsis thaliana] Length = 531 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/63 (47%), Positives = 44/63 (69%), Gaps = 3/63 (4%) Frame = -1 Query: 474 CRVGFGPSVILCSLTAGKNESCELDLDFDEDMEIIFSVDGPHSVHLTGYYRDKR---KPS 304 C VG ++LC LT K +SC+L+L+F+E E+IFSV GP SVHLTGY+ + +P+ Sbjct: 51 CNVGNKSPLLLCVLTPDKVDSCQLNLEFEETDEVIFSVIGPRSVHLTGYFLGRSTGFRPN 110 Query: 303 EDD 295 +D+ Sbjct: 111 DDE 113 >ref|NP_187840.7| FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Arabidopsis thaliana] gi|380876925|sp|F4J9Q6.1|FKB43_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase FKBP43; Short=PPIase FKBP43; AltName: Full=FK506-binding protein 43; Short=AtFKBP43; AltName: Full=Immunophilin FKBP43; AltName: Full=Rotamase gi|332641663|gb|AEE75184.1| FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Arabidopsis thaliana] Length = 499 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/63 (47%), Positives = 44/63 (69%), Gaps = 3/63 (4%) Frame = -1 Query: 474 CRVGFGPSVILCSLTAGKNESCELDLDFDEDMEIIFSVDGPHSVHLTGYYRDKR---KPS 304 C VG ++LC LT K +SC+L+L+F+E E+IFSV GP SVHLTGY+ + +P+ Sbjct: 47 CNVGNKSPLLLCVLTPDKVDSCQLNLEFEETDEVIFSVIGPRSVHLTGYFLGRSTGFRPN 106 Query: 303 EDD 295 +D+ Sbjct: 107 DDE 109 >ref|XP_006478156.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP43-like [Citrus sinensis] Length = 612 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/52 (57%), Positives = 37/52 (71%) Frame = -1 Query: 480 VLCRVGFGPSVILCSLTAGKNESCELDLDFDEDMEIIFSVDGPHSVHLTGYY 325 V C VG V LCSL K ESC+L+L+F+E E++FSV GP SVHLTGY+ Sbjct: 43 VQCNVGDKSPVFLCSLFPEKAESCQLNLEFEEADEVVFSVIGPQSVHLTGYF 94 >ref|XP_006441495.1| hypothetical protein CICLE_v10019343mg [Citrus clementina] gi|557543757|gb|ESR54735.1| hypothetical protein CICLE_v10019343mg [Citrus clementina] Length = 612 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/52 (57%), Positives = 37/52 (71%) Frame = -1 Query: 480 VLCRVGFGPSVILCSLTAGKNESCELDLDFDEDMEIIFSVDGPHSVHLTGYY 325 V C VG V LCSL K ESC+L+L+F+E E++FSV GP SVHLTGY+ Sbjct: 43 VQCNVGDKSPVFLCSLFPEKAESCQLNLEFEEADEVVFSVIGPQSVHLTGYF 94 >ref|XP_006851835.1| hypothetical protein AMTR_s00041p00068660 [Amborella trichopoda] gi|548855418|gb|ERN13302.1| hypothetical protein AMTR_s00041p00068660 [Amborella trichopoda] Length = 512 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/68 (42%), Positives = 43/68 (63%), Gaps = 1/68 (1%) Frame = -1 Query: 489 RCNVLCRVGFGPSVILCSLTAGKNESCELDLDFDEDMEIIFSVDGPHSVHLTGYYR-DKR 313 R ++ C +G V+LC L+ ++C +D++F+E+ E++FSV GP SVHL GYY R Sbjct: 40 RSSLQCNIGNKSPVLLCVLSENHTDNCSIDVEFEEEEEVVFSVLGPRSVHLIGYYMVPDR 99 Query: 312 KPSEDDYS 289 P ED S Sbjct: 100 GPEEDSES 107 >ref|XP_007219679.1| hypothetical protein PRUPE_ppa025416mg [Prunus persica] gi|462416141|gb|EMJ20878.1| hypothetical protein PRUPE_ppa025416mg [Prunus persica] Length = 489 Score = 63.2 bits (152), Expect = 4e-08 Identities = 33/67 (49%), Positives = 42/67 (62%), Gaps = 1/67 (1%) Frame = -1 Query: 489 RCNVLCRVGFGPSVILCSLTAGKNESCELDLDFD-EDMEIIFSVDGPHSVHLTGYYRDKR 313 R V C +G+ + LCSL KNESC LDL+F+ D I FSV G SVHL+GY+ D Sbjct: 40 RSIVQCSMGYKSPIFLCSLLPNKNESCPLDLEFEGVDGLIDFSVIGKRSVHLSGYFVDDD 99 Query: 312 KPSEDDY 292 + + DDY Sbjct: 100 RDARDDY 106 >ref|XP_007038455.1| Fk506 binding protein 53, putative isoform 2 [Theobroma cacao] gi|508775700|gb|EOY22956.1| Fk506 binding protein 53, putative isoform 2 [Theobroma cacao] Length = 445 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/56 (51%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = -1 Query: 489 RCNVLCRVGFGPSVILCSLTAGKNESCELDLDFDEDMEII-FSVDGPHSVHLTGYY 325 R + C VG +ILCSL +NE+C LDL FDED +++ FSV GP S+HL+GY+ Sbjct: 40 RAVLQCSVGHKSPIILCSLLPNQNETCSLDLKFDEDDDLVAFSVIGPRSIHLSGYF 95 >ref|XP_007038454.1| FK506-binding protein, putative isoform 1 [Theobroma cacao] gi|508775699|gb|EOY22955.1| FK506-binding protein, putative isoform 1 [Theobroma cacao] Length = 502 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/56 (51%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = -1 Query: 489 RCNVLCRVGFGPSVILCSLTAGKNESCELDLDFDEDMEII-FSVDGPHSVHLTGYY 325 R + C VG +ILCSL +NE+C LDL FDED +++ FSV GP S+HL+GY+ Sbjct: 40 RAVLQCSVGHKSPIILCSLLPNQNETCSLDLKFDEDDDLVAFSVIGPRSIHLSGYF 95 >ref|XP_002989733.1| hypothetical protein SELMODRAFT_428238 [Selaginella moellendorffii] gi|300142510|gb|EFJ09210.1| hypothetical protein SELMODRAFT_428238 [Selaginella moellendorffii] Length = 378 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/62 (45%), Positives = 42/62 (67%) Frame = -1 Query: 474 CRVGFGPSVILCSLTAGKNESCELDLDFDEDMEIIFSVDGPHSVHLTGYYRDKRKPSEDD 295 C+ G GP V +CSL G +E+C LDL+F++D ++FSV G ++HL+GYY + +DD Sbjct: 47 CKGGEGPPVFVCSLKPGLHETCYLDLNFEDD--VVFSVTGSTAIHLSGYYMEPFSDEDDD 104 Query: 294 YS 289 S Sbjct: 105 ES 106 >ref|XP_006339431.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP43-like [Solanum tuberosum] Length = 552 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/52 (53%), Positives = 36/52 (69%) Frame = -1 Query: 480 VLCRVGFGPSVILCSLTAGKNESCELDLDFDEDMEIIFSVDGPHSVHLTGYY 325 V C VG V LC+L K ESC LDL+F+E +++FSV GP +V+LTGYY Sbjct: 43 VQCNVGNKSPVFLCALLPNKTESCHLDLEFEEAEDVVFSVLGPRTVYLTGYY 94 >ref|XP_004229814.1| PREDICTED: uncharacterized protein LOC101252817 [Solanum lycopersicum] Length = 551 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/52 (53%), Positives = 36/52 (69%) Frame = -1 Query: 480 VLCRVGFGPSVILCSLTAGKNESCELDLDFDEDMEIIFSVDGPHSVHLTGYY 325 V C VG V LC+L K ESC LDL+F+E +++FSV GP +V+LTGYY Sbjct: 43 VQCNVGNKSPVFLCALLPNKTESCHLDLEFEEAEDVVFSVLGPRTVYLTGYY 94