BLASTX nr result
ID: Papaver25_contig00035318
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00035318 (447 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006485433.1| PREDICTED: protein phosphatase 2C 29-like [C... 74 2e-11 ref|XP_006352839.1| PREDICTED: protein phosphatase 2C 29-like [S... 74 2e-11 ref|XP_006436752.1| hypothetical protein CICLE_v100317272mg, par... 74 2e-11 ref|XP_006385628.1| hypothetical protein POPTR_0003s08790g [Popu... 74 2e-11 ref|XP_007039547.1| Poltergeist like 1 isoform 1 [Theobroma caca... 74 2e-11 ref|XP_004509008.1| PREDICTED: protein phosphatase 2C 29-like is... 74 2e-11 ref|XP_004301696.1| PREDICTED: protein phosphatase 2C 29-like [F... 74 2e-11 ref|XP_007211303.1| hypothetical protein PRUPE_ppa001785mg [Prun... 74 2e-11 ref|XP_004245878.1| PREDICTED: protein phosphatase 2C 29-like [S... 74 2e-11 ref|XP_004167593.1| PREDICTED: protein phosphatase 2C 29-like [C... 74 2e-11 ref|XP_004148729.1| PREDICTED: protein phosphatase 2C 29-like [C... 74 2e-11 ref|XP_003608636.1| Protein phosphatase 2C [Medicago truncatula]... 74 2e-11 ref|XP_002278429.1| PREDICTED: protein phosphatase 2C 29-like [V... 74 2e-11 ref|XP_002519843.1| protein phosphatase 2c, putative [Ricinus co... 74 2e-11 ref|XP_006368428.1| phosphatase 2C family protein [Populus trich... 74 2e-11 gb|EYU33042.1| hypothetical protein MIMGU_mgv1a0222051mg, partia... 74 3e-11 gb|EYU17848.1| hypothetical protein MIMGU_mgv1a0231131mg, partia... 74 3e-11 ref|XP_006362499.1| PREDICTED: protein phosphatase 2C 29-like [S... 74 3e-11 ref|XP_004244702.1| PREDICTED: protein phosphatase 2C 29-like [S... 74 3e-11 ref|XP_006847698.1| hypothetical protein AMTR_s00149p00066780 [A... 73 4e-11 >ref|XP_006485433.1| PREDICTED: protein phosphatase 2C 29-like [Citrus sinensis] Length = 792 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 102 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL Sbjct: 759 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 792 >ref|XP_006352839.1| PREDICTED: protein phosphatase 2C 29-like [Solanum tuberosum] Length = 798 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 102 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL Sbjct: 765 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 798 >ref|XP_006436752.1| hypothetical protein CICLE_v100317272mg, partial [Citrus clementina] gi|557538948|gb|ESR49992.1| hypothetical protein CICLE_v100317272mg, partial [Citrus clementina] Length = 167 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 102 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL Sbjct: 134 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 167 >ref|XP_006385628.1| hypothetical protein POPTR_0003s08790g [Populus trichocarpa] gi|550342758|gb|ERP63425.1| hypothetical protein POPTR_0003s08790g [Populus trichocarpa] Length = 169 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 102 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL Sbjct: 136 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 169 >ref|XP_007039547.1| Poltergeist like 1 isoform 1 [Theobroma cacao] gi|508776792|gb|EOY24048.1| Poltergeist like 1 isoform 1 [Theobroma cacao] Length = 786 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 102 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL Sbjct: 753 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 786 >ref|XP_004509008.1| PREDICTED: protein phosphatase 2C 29-like isoform X1 [Cicer arietinum] Length = 775 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 102 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL Sbjct: 742 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 775 >ref|XP_004301696.1| PREDICTED: protein phosphatase 2C 29-like [Fragaria vesca subsp. vesca] Length = 761 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 102 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL Sbjct: 728 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 761 >ref|XP_007211303.1| hypothetical protein PRUPE_ppa001785mg [Prunus persica] gi|462407038|gb|EMJ12502.1| hypothetical protein PRUPE_ppa001785mg [Prunus persica] Length = 765 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 102 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL Sbjct: 732 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 765 >ref|XP_004245878.1| PREDICTED: protein phosphatase 2C 29-like [Solanum lycopersicum] Length = 796 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 102 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL Sbjct: 763 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 796 >ref|XP_004167593.1| PREDICTED: protein phosphatase 2C 29-like [Cucumis sativus] Length = 782 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 102 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL Sbjct: 749 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 782 >ref|XP_004148729.1| PREDICTED: protein phosphatase 2C 29-like [Cucumis sativus] Length = 781 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 102 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL Sbjct: 748 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 781 >ref|XP_003608636.1| Protein phosphatase 2C [Medicago truncatula] gi|355509691|gb|AES90833.1| Protein phosphatase 2C [Medicago truncatula] Length = 818 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 102 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL Sbjct: 785 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 818 >ref|XP_002278429.1| PREDICTED: protein phosphatase 2C 29-like [Vitis vinifera] Length = 822 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 102 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL Sbjct: 789 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 822 >ref|XP_002519843.1| protein phosphatase 2c, putative [Ricinus communis] gi|223540889|gb|EEF42447.1| protein phosphatase 2c, putative [Ricinus communis] Length = 749 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 102 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL Sbjct: 716 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 749 >ref|XP_006368428.1| phosphatase 2C family protein [Populus trichocarpa] gi|550346341|gb|ERP64997.1| phosphatase 2C family protein [Populus trichocarpa] Length = 783 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 102 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL Sbjct: 750 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 783 >gb|EYU33042.1| hypothetical protein MIMGU_mgv1a0222051mg, partial [Mimulus guttatus] Length = 574 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = +1 Query: 1 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 102 LDIPQGDRRKYHDDVTVMV+SLEGRIWKSSGKYL Sbjct: 541 LDIPQGDRRKYHDDVTVMVVSLEGRIWKSSGKYL 574 >gb|EYU17848.1| hypothetical protein MIMGU_mgv1a0231131mg, partial [Mimulus guttatus] Length = 167 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = +1 Query: 1 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 102 LDIPQGDRRKYHDDVTVMV+SLEGRIWKSSGKYL Sbjct: 134 LDIPQGDRRKYHDDVTVMVVSLEGRIWKSSGKYL 167 >ref|XP_006362499.1| PREDICTED: protein phosphatase 2C 29-like [Solanum tuberosum] Length = 781 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = +1 Query: 1 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 102 LDIPQGDRRKYHDDVTVMV+SLEGRIWKSSGKYL Sbjct: 748 LDIPQGDRRKYHDDVTVMVVSLEGRIWKSSGKYL 781 >ref|XP_004244702.1| PREDICTED: protein phosphatase 2C 29-like [Solanum lycopersicum] Length = 781 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = +1 Query: 1 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 102 LDIPQGDRRKYHDDVTVMV+SLEGRIWKSSGKYL Sbjct: 748 LDIPQGDRRKYHDDVTVMVVSLEGRIWKSSGKYL 781 >ref|XP_006847698.1| hypothetical protein AMTR_s00149p00066780 [Amborella trichopoda] gi|548850967|gb|ERN09279.1| hypothetical protein AMTR_s00149p00066780 [Amborella trichopoda] Length = 981 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = +1 Query: 1 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 102 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKY+ Sbjct: 948 LDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYI 981