BLASTX nr result
ID: Papaver25_contig00035112
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00035112 (418 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW73968.1| hypothetical protein ZEAMMB73_800087 [Zea mays] 52 3e-07 gb|AFW73967.1| hypothetical protein ZEAMMB73_800087, partial [Ze... 52 3e-07 >gb|AFW73968.1| hypothetical protein ZEAMMB73_800087 [Zea mays] Length = 895 Score = 52.0 bits (123), Expect(2) = 3e-07 Identities = 21/33 (63%), Positives = 27/33 (81%) Frame = -2 Query: 282 KSHTMFGCDKQPGVIHRALKEDILGGEGDLKSD 184 KSHTMFGC KQPG+++RAL++ + GGEGD D Sbjct: 141 KSHTMFGCTKQPGIVYRALRDILEGGEGDSAED 173 Score = 28.1 bits (61), Expect(2) = 3e-07 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -1 Query: 352 VQGTQAAQGSKCTIMAYGSTSSDK 281 +QG + G+KCT+M YG T S K Sbjct: 120 IQGVRV--GAKCTVMVYGPTGSGK 141 >gb|AFW73967.1| hypothetical protein ZEAMMB73_800087, partial [Zea mays] Length = 860 Score = 52.0 bits (123), Expect(2) = 3e-07 Identities = 21/33 (63%), Positives = 27/33 (81%) Frame = -2 Query: 282 KSHTMFGCDKQPGVIHRALKEDILGGEGDLKSD 184 KSHTMFGC KQPG+++RAL++ + GGEGD D Sbjct: 141 KSHTMFGCTKQPGIVYRALRDILEGGEGDSAED 173 Score = 28.1 bits (61), Expect(2) = 3e-07 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -1 Query: 352 VQGTQAAQGSKCTIMAYGSTSSDK 281 +QG + G+KCT+M YG T S K Sbjct: 120 IQGVRV--GAKCTVMVYGPTGSGK 141