BLASTX nr result
ID: Papaver25_contig00034901
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00034901 (622 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25741.1| hypothetical protein MIMGU_mgv1a006821mg [Mimulus... 56 1e-05 >gb|EYU25741.1| hypothetical protein MIMGU_mgv1a006821mg [Mimulus guttatus] Length = 430 Score = 55.8 bits (133), Expect = 1e-05 Identities = 32/59 (54%), Positives = 37/59 (62%) Frame = +1 Query: 400 TKEHRLVKSPKLQEN*VNQGALRVHILLAFSGLMQALANNPGYNCRVLEGIETAKALLE 576 TKEH+LV+ PK + R ILLAFSGL QAL NPGYN RV E E A+ LL+ Sbjct: 215 TKEHKLVQCPKSSGIHNKETDKRFKILLAFSGLKQALITNPGYNSRVSECREAARILLK 273