BLASTX nr result
ID: Papaver25_contig00034640
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00034640 (689 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002886871.1| predicted protein [Arabidopsis lyrata subsp.... 52 2e-06 >ref|XP_002886871.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297332712|gb|EFH63130.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 57 Score = 51.6 bits (122), Expect(2) = 2e-06 Identities = 25/41 (60%), Positives = 27/41 (65%) Frame = -1 Query: 200 KNYASQFHNPIFHFELTLGYKSRECIFFLKSFIER*RIKSF 78 KNY S+FHNP GYK RE I FL+SFIER R KSF Sbjct: 17 KNYVSEFHNPNLQLIRVFGYKLRESIIFLESFIERERTKSF 57 Score = 26.6 bits (57), Expect(2) = 2e-06 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -2 Query: 250 MDPLFILIQLEVLIQLK 200 MDPL ILI+L ++IQ K Sbjct: 1 MDPLVILIELSIVIQFK 17