BLASTX nr result
ID: Papaver25_contig00034570
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00034570 (471 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q9SQ64.1|COR2_PAPSO RecName: Full=Non-functional NADPH-depend... 57 2e-06 ref|XP_006441703.1| hypothetical protein CICLE_v10024358mg [Citr... 57 3e-06 >sp|Q9SQ64.1|COR2_PAPSO RecName: Full=Non-functional NADPH-dependent codeinone reductase 2 gi|6478216|gb|AAF13742.1|AF108438_1 putative NADPH-dependent oxidoreductase [Papaver somniferum] Length = 321 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = -2 Query: 125 RKLKLEYLDLYLIHWPVSSNPVAGLVFPLPKDALLTMDYKS 3 R LKLEYLDLYLIHWPVS P V P+PKD + +DYKS Sbjct: 106 RNLKLEYLDLYLIHWPVSLKP-GKFVHPIPKDEIFPIDYKS 145 >ref|XP_006441703.1| hypothetical protein CICLE_v10024358mg [Citrus clementina] gi|557543965|gb|ESR54943.1| hypothetical protein CICLE_v10024358mg [Citrus clementina] Length = 292 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = -2 Query: 119 LKLEYLDLYLIHWPVSSNPVAGLVFPLPKDALLTMDYK 6 L++EYLDLYLIHWP+SS PV P+PK+ LL MDYK Sbjct: 116 LQIEYLDLYLIHWPISSKPVEMGFAPVPKEDLLPMDYK 153