BLASTX nr result
ID: Papaver25_contig00034371
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00034371 (832 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006473637.1| PREDICTED: 5'-3' exoribonuclease 3-like isof... 61 6e-07 ref|XP_006473636.1| PREDICTED: 5'-3' exoribonuclease 3-like isof... 61 6e-07 ref|XP_006435155.1| hypothetical protein CICLE_v10000087mg [Citr... 61 6e-07 ref|XP_006435154.1| hypothetical protein CICLE_v10000087mg [Citr... 61 6e-07 ref|XP_006390286.1| hypothetical protein EUTSA_v10018062mg [Eutr... 61 6e-07 ref|XP_006300301.1| hypothetical protein CARUB_v10019710mg [Caps... 61 6e-07 gb|AAF87130.1|AC006434_26 F10A5.15 [Arabidopsis thaliana] 61 6e-07 ref|NP_565114.1| 5'-3' exoribonuclease 3 [Arabidopsis thaliana] ... 61 6e-07 gb|AAM97049.1| unknown protein [Arabidopsis thaliana] gi|2319793... 61 6e-07 ref|XP_006342032.1| PREDICTED: 5'-3' exoribonuclease 3-like [Sol... 60 1e-06 ref|XP_004238343.1| PREDICTED: 5'-3' exoribonuclease 3-like [Sol... 60 1e-06 ref|XP_007017772.1| 5'-3' exoribonuclease 3 isoform 2 [Theobroma... 60 1e-06 ref|XP_007017771.1| 5'-3' exoribonuclease 3 isoform 1 [Theobroma... 60 1e-06 ref|XP_004291380.1| PREDICTED: 5'-3' exoribonuclease 3-like [Fra... 60 1e-06 ref|XP_002280236.2| PREDICTED: 5'-3' exoribonuclease 3-like [Vit... 60 1e-06 emb|CBI19841.3| unnamed protein product [Vitis vinifera] 60 1e-06 ref|XP_002510514.1| 5'->3' exoribonuclease, putative [Ricinus co... 59 2e-06 ref|XP_006417024.1| hypothetical protein EUTSA_v10009553mg, part... 59 2e-06 ref|XP_004171370.1| PREDICTED: 5'-3' exoribonuclease 3-like [Cuc... 59 2e-06 ref|XP_004143781.1| PREDICTED: 5'-3' exoribonuclease 3-like [Cuc... 59 2e-06 >ref|XP_006473637.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X2 [Citrus sinensis] Length = 1120 Score = 60.8 bits (146), Expect = 6e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +2 Query: 509 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 601 +PA TTF+EVFQCMFDYIDRLF MVRPRKLL Sbjct: 68 RPAPTTFDEVFQCMFDYIDRLFVMVRPRKLL 98 >ref|XP_006473636.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X1 [Citrus sinensis] Length = 1123 Score = 60.8 bits (146), Expect = 6e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +2 Query: 509 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 601 +PA TTF+EVFQCMFDYIDRLF MVRPRKLL Sbjct: 68 RPAPTTFDEVFQCMFDYIDRLFVMVRPRKLL 98 >ref|XP_006435155.1| hypothetical protein CICLE_v10000087mg [Citrus clementina] gi|557537277|gb|ESR48395.1| hypothetical protein CICLE_v10000087mg [Citrus clementina] Length = 1123 Score = 60.8 bits (146), Expect = 6e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +2 Query: 509 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 601 +PA TTF+EVFQCMFDYIDRLF MVRPRKLL Sbjct: 68 RPAPTTFDEVFQCMFDYIDRLFVMVRPRKLL 98 >ref|XP_006435154.1| hypothetical protein CICLE_v10000087mg [Citrus clementina] gi|557537276|gb|ESR48394.1| hypothetical protein CICLE_v10000087mg [Citrus clementina] Length = 1120 Score = 60.8 bits (146), Expect = 6e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +2 Query: 509 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 601 +PA TTF+EVFQCMFDYIDRLF MVRPRKLL Sbjct: 68 RPAPTTFDEVFQCMFDYIDRLFVMVRPRKLL 98 >ref|XP_006390286.1| hypothetical protein EUTSA_v10018062mg [Eutrema salsugineum] gi|557086720|gb|ESQ27572.1| hypothetical protein EUTSA_v10018062mg [Eutrema salsugineum] Length = 1023 Score = 60.8 bits (146), Expect = 6e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +2 Query: 509 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 601 +P+ TTFEEVFQCMFDYIDRLF MVRPRKLL Sbjct: 68 RPSPTTFEEVFQCMFDYIDRLFVMVRPRKLL 98 >ref|XP_006300301.1| hypothetical protein CARUB_v10019710mg [Capsella rubella] gi|482569011|gb|EOA33199.1| hypothetical protein CARUB_v10019710mg [Capsella rubella] Length = 1024 Score = 60.8 bits (146), Expect = 6e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +2 Query: 509 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 601 +P+ TTFEEVFQCMFDYIDRLF MVRPRKLL Sbjct: 68 RPSPTTFEEVFQCMFDYIDRLFVMVRPRKLL 98 >gb|AAF87130.1|AC006434_26 F10A5.15 [Arabidopsis thaliana] Length = 1037 Score = 60.8 bits (146), Expect = 6e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +2 Query: 509 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 601 +P+ TTFEEVFQCMFDYIDRLF MVRPRKLL Sbjct: 68 RPSPTTFEEVFQCMFDYIDRLFVMVRPRKLL 98 >ref|NP_565114.1| 5'-3' exoribonuclease 3 [Arabidopsis thaliana] gi|75262832|sp|Q9FQ03.1|XRN3_ARATH RecName: Full=5'-3' exoribonuclease 3; AltName: Full=Protein EXORIBONUCLEASE 3 gi|11875628|gb|AAG40732.1|AF286719_1 XRN3 [Arabidopsis thaliana] gi|332197621|gb|AEE35742.1| 5'-3' exoribonuclease 3 [Arabidopsis thaliana] Length = 1020 Score = 60.8 bits (146), Expect = 6e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +2 Query: 509 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 601 +P+ TTFEEVFQCMFDYIDRLF MVRPRKLL Sbjct: 68 RPSPTTFEEVFQCMFDYIDRLFVMVRPRKLL 98 >gb|AAM97049.1| unknown protein [Arabidopsis thaliana] gi|23197934|gb|AAN15494.1| unknown protein [Arabidopsis thaliana] Length = 763 Score = 60.8 bits (146), Expect = 6e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +2 Query: 509 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 601 +P+ TTFEEVFQCMFDYIDRLF MVRPRKLL Sbjct: 68 RPSPTTFEEVFQCMFDYIDRLFVMVRPRKLL 98 >ref|XP_006342032.1| PREDICTED: 5'-3' exoribonuclease 3-like [Solanum tuberosum] Length = 1099 Score = 60.1 bits (144), Expect = 1e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +2 Query: 509 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 601 +P+ TTFEEVF+CMFDYIDRLF+MVRPRKLL Sbjct: 68 RPSPTTFEEVFECMFDYIDRLFSMVRPRKLL 98 >ref|XP_004238343.1| PREDICTED: 5'-3' exoribonuclease 3-like [Solanum lycopersicum] Length = 1109 Score = 60.1 bits (144), Expect = 1e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +2 Query: 509 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 601 +P+ TTFEEVF+CMFDYIDRLF+MVRPRKLL Sbjct: 68 RPSPTTFEEVFECMFDYIDRLFSMVRPRKLL 98 >ref|XP_007017772.1| 5'-3' exoribonuclease 3 isoform 2 [Theobroma cacao] gi|508723100|gb|EOY14997.1| 5'-3' exoribonuclease 3 isoform 2 [Theobroma cacao] Length = 1110 Score = 59.7 bits (143), Expect = 1e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +2 Query: 509 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 601 +P+ TTF+EVFQCMFDYIDRLF MVRPRKLL Sbjct: 68 RPSPTTFDEVFQCMFDYIDRLFVMVRPRKLL 98 >ref|XP_007017771.1| 5'-3' exoribonuclease 3 isoform 1 [Theobroma cacao] gi|508723099|gb|EOY14996.1| 5'-3' exoribonuclease 3 isoform 1 [Theobroma cacao] Length = 1106 Score = 59.7 bits (143), Expect = 1e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +2 Query: 509 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 601 +P+ TTF+EVFQCMFDYIDRLF MVRPRKLL Sbjct: 68 RPSPTTFDEVFQCMFDYIDRLFVMVRPRKLL 98 >ref|XP_004291380.1| PREDICTED: 5'-3' exoribonuclease 3-like [Fragaria vesca subsp. vesca] Length = 1052 Score = 59.7 bits (143), Expect = 1e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +2 Query: 509 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 601 +P+ TTF+EVFQCMFDYIDRLF MVRPRKLL Sbjct: 67 RPSPTTFDEVFQCMFDYIDRLFVMVRPRKLL 97 >ref|XP_002280236.2| PREDICTED: 5'-3' exoribonuclease 3-like [Vitis vinifera] Length = 1065 Score = 59.7 bits (143), Expect = 1e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +2 Query: 509 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 601 +P+ TTF+EVFQCMFDYIDRLF MVRPRKLL Sbjct: 68 RPSPTTFDEVFQCMFDYIDRLFVMVRPRKLL 98 >emb|CBI19841.3| unnamed protein product [Vitis vinifera] Length = 870 Score = 59.7 bits (143), Expect = 1e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +2 Query: 509 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 601 +P+ TTF+EVFQCMFDYIDRLF MVRPRKLL Sbjct: 68 RPSPTTFDEVFQCMFDYIDRLFVMVRPRKLL 98 >ref|XP_002510514.1| 5'->3' exoribonuclease, putative [Ricinus communis] gi|223551215|gb|EEF52701.1| 5'->3' exoribonuclease, putative [Ricinus communis] Length = 1113 Score = 59.3 bits (142), Expect = 2e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +2 Query: 509 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 601 +P+ T+FEEVFQCMFDYIDRLF MVRPRKLL Sbjct: 68 RPSPTSFEEVFQCMFDYIDRLFVMVRPRKLL 98 >ref|XP_006417024.1| hypothetical protein EUTSA_v10009553mg, partial [Eutrema salsugineum] gi|557094795|gb|ESQ35377.1| hypothetical protein EUTSA_v10009553mg, partial [Eutrema salsugineum] Length = 902 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 509 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 601 +P+ TTF EVFQCMFDYIDRLF MVRPRKLL Sbjct: 72 RPSPTTFSEVFQCMFDYIDRLFVMVRPRKLL 102 >ref|XP_004171370.1| PREDICTED: 5'-3' exoribonuclease 3-like [Cucumis sativus] Length = 373 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 509 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 601 +P+ TTF EVFQCMFDYIDRLF MVRPRKLL Sbjct: 68 RPSPTTFSEVFQCMFDYIDRLFVMVRPRKLL 98 >ref|XP_004143781.1| PREDICTED: 5'-3' exoribonuclease 3-like [Cucumis sativus] Length = 1101 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 509 QPASTTFEEVFQCMFDYIDRLFAMVRPRKLL 601 +P+ TTF EVFQCMFDYIDRLF MVRPRKLL Sbjct: 68 RPSPTTFSEVFQCMFDYIDRLFVMVRPRKLL 98