BLASTX nr result
ID: Papaver25_contig00034140
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00034140 (465 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33972.1| hypothetical protein MIMGU_mgv1a003655mg [Mimulus... 100 2e-19 gb|EYU24143.1| hypothetical protein MIMGU_mgv1a003175mg [Mimulus... 100 2e-19 gb|EXC34965.1| putative auxin efflux carrier component 1c [Morus... 100 2e-19 dbj|BAO49655.1| putative auxin efflux carrier protein [Vigna ang... 100 2e-19 dbj|BAO49652.1| putative auxin efflux carrier protein [Vigna ang... 100 2e-19 ref|XP_006490772.1| PREDICTED: probable auxin efflux carrier com... 100 2e-19 ref|XP_007162070.1| hypothetical protein PHAVU_001G121100g [Phas... 100 2e-19 ref|XP_007160541.1| hypothetical protein PHAVU_002G330300g [Phas... 100 2e-19 ref|XP_006826885.1| hypothetical protein AMTR_s00010p00137670 [A... 100 2e-19 ref|XP_004493383.1| PREDICTED: probable auxin efflux carrier com... 100 2e-19 ref|NP_001276315.1| uncharacterized protein LOC100802041 [Glycin... 100 2e-19 ref|XP_004299530.1| PREDICTED: auxin efflux carrier component 1-... 100 2e-19 ref|XP_007210282.1| hypothetical protein PRUPE_ppa002944mg [Prun... 100 2e-19 ref|XP_007204212.1| hypothetical protein PRUPE_ppa003159mg [Prun... 100 2e-19 ref|XP_004144328.1| PREDICTED: probable auxin efflux carrier com... 100 2e-19 gb|ABQ95663.1| auxin efflux carrier, partial [Malus domestica] 100 2e-19 gb|ABQ95664.1| auxin efflux carrier, partial [Malus domestica] 100 2e-19 gb|ABQ95658.1| auxin efflux carrier, partial [Malus domestica] 100 2e-19 gb|AFK46028.1| unknown [Lotus japonicus] 100 2e-19 ref|XP_002282640.2| PREDICTED: probable auxin efflux carrier com... 100 2e-19 >gb|EYU33972.1| hypothetical protein MIMGU_mgv1a003655mg [Mimulus guttatus] Length = 571 Score = 100 bits (250), Expect = 2e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -3 Query: 463 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 314 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 522 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 571 >gb|EYU24143.1| hypothetical protein MIMGU_mgv1a003175mg [Mimulus guttatus] Length = 603 Score = 100 bits (250), Expect = 2e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -3 Query: 463 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 314 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 554 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 603 >gb|EXC34965.1| putative auxin efflux carrier component 1c [Morus notabilis] Length = 588 Score = 100 bits (250), Expect = 2e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -3 Query: 463 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 314 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 539 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 588 >dbj|BAO49655.1| putative auxin efflux carrier protein [Vigna angularis] Length = 586 Score = 100 bits (250), Expect = 2e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -3 Query: 463 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 314 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 537 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 586 >dbj|BAO49652.1| putative auxin efflux carrier protein [Vigna angularis] Length = 592 Score = 100 bits (250), Expect = 2e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -3 Query: 463 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 314 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 543 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 592 >ref|XP_006490772.1| PREDICTED: probable auxin efflux carrier component 1c-like [Citrus sinensis] Length = 604 Score = 100 bits (250), Expect = 2e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -3 Query: 463 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 314 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 555 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 604 >ref|XP_007162070.1| hypothetical protein PHAVU_001G121100g [Phaseolus vulgaris] gi|561035534|gb|ESW34064.1| hypothetical protein PHAVU_001G121100g [Phaseolus vulgaris] Length = 585 Score = 100 bits (250), Expect = 2e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -3 Query: 463 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 314 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 536 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 585 >ref|XP_007160541.1| hypothetical protein PHAVU_002G330300g [Phaseolus vulgaris] gi|561033956|gb|ESW32535.1| hypothetical protein PHAVU_002G330300g [Phaseolus vulgaris] Length = 595 Score = 100 bits (250), Expect = 2e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -3 Query: 463 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 314 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 545 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 594 >ref|XP_006826885.1| hypothetical protein AMTR_s00010p00137670 [Amborella trichopoda] gi|548831314|gb|ERM94122.1| hypothetical protein AMTR_s00010p00137670 [Amborella trichopoda] Length = 627 Score = 100 bits (250), Expect = 2e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -3 Query: 463 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 314 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 578 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 627 >ref|XP_004493383.1| PREDICTED: probable auxin efflux carrier component 1c-like [Cicer arietinum] Length = 591 Score = 100 bits (250), Expect = 2e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -3 Query: 463 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 314 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 541 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 590 >ref|NP_001276315.1| uncharacterized protein LOC100802041 [Glycine max] gi|481044574|gb|AGJ95069.1| PIN10a [Glycine max] Length = 555 Score = 100 bits (250), Expect = 2e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -3 Query: 463 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 314 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 506 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 555 >ref|XP_004299530.1| PREDICTED: auxin efflux carrier component 1-like [Fragaria vesca subsp. vesca] Length = 620 Score = 100 bits (250), Expect = 2e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -3 Query: 463 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 314 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 571 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 620 >ref|XP_007210282.1| hypothetical protein PRUPE_ppa002944mg [Prunus persica] gi|462406017|gb|EMJ11481.1| hypothetical protein PRUPE_ppa002944mg [Prunus persica] Length = 619 Score = 100 bits (250), Expect = 2e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -3 Query: 463 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 314 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 570 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 619 >ref|XP_007204212.1| hypothetical protein PRUPE_ppa003159mg [Prunus persica] gi|462399743|gb|EMJ05411.1| hypothetical protein PRUPE_ppa003159mg [Prunus persica] Length = 597 Score = 100 bits (250), Expect = 2e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -3 Query: 463 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 314 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 548 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 597 >ref|XP_004144328.1| PREDICTED: probable auxin efflux carrier component 1c-like [Cucumis sativus] gi|449488241|ref|XP_004157978.1| PREDICTED: probable auxin efflux carrier component 1c-like [Cucumis sativus] Length = 596 Score = 100 bits (250), Expect = 2e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -3 Query: 463 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 314 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 547 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 596 >gb|ABQ95663.1| auxin efflux carrier, partial [Malus domestica] Length = 481 Score = 100 bits (250), Expect = 2e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -3 Query: 463 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 314 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 432 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 481 >gb|ABQ95664.1| auxin efflux carrier, partial [Malus domestica] Length = 481 Score = 100 bits (250), Expect = 2e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -3 Query: 463 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 314 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 432 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 481 >gb|ABQ95658.1| auxin efflux carrier, partial [Malus domestica] Length = 483 Score = 100 bits (250), Expect = 2e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -3 Query: 463 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 314 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 434 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 483 >gb|AFK46028.1| unknown [Lotus japonicus] Length = 493 Score = 100 bits (250), Expect = 2e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -3 Query: 463 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 314 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 440 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 489 >ref|XP_002282640.2| PREDICTED: probable auxin efflux carrier component 1c-like isoform 1 [Vitis vinifera] Length = 619 Score = 100 bits (250), Expect = 2e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -3 Query: 463 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 314 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 570 IVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 619