BLASTX nr result
ID: Papaver25_contig00032819
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00032819 (436 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB52559.1| putative Xaa-Pro aminopeptidase P [Morus notabilis] 57 3e-06 >gb|EXB52559.1| putative Xaa-Pro aminopeptidase P [Morus notabilis] Length = 748 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/57 (52%), Positives = 39/57 (68%), Gaps = 2/57 (3%) Frame = -3 Query: 434 IVKEHTLP--F*RNQKFGFENNTLVLIQAKVLELSLMSAADINCLNDYHSQFWKKGR 270 +VKE P F + GFE T V IQAK+++L+L+SA +I LNDYHSQ W+KGR Sbjct: 626 VVKEADTPIRFGGIEYLGFEKLTFVPIQAKLIDLTLLSAEEITWLNDYHSQVWEKGR 682