BLASTX nr result
ID: Papaver25_contig00032689
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00032689 (461 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520270.1| protein transporter, putative [Ricinus commu... 56 6e-06 >ref|XP_002520270.1| protein transporter, putative [Ricinus communis] gi|223540489|gb|EEF42056.1| protein transporter, putative [Ricinus communis] Length = 520 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = -1 Query: 461 LVGQTQNLSLNGSTSRTSSIPTKQSKSEDELFQDLLDFAKKKS 333 LVGQTQNLSLN ST PTKQ+K ED LF+DL+DFAK KS Sbjct: 474 LVGQTQNLSLNSST------PTKQTKPEDALFKDLVDFAKAKS 510