BLASTX nr result
ID: Papaver25_contig00032533
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00032533 (663 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC20292.1| 26S proteasome non-ATPase regulatory subunit 11 [... 90 6e-16 ref|XP_007222547.1| hypothetical protein PRUPE_ppa006204mg [Prun... 89 2e-15 ref|XP_002319533.1| 19S proteosome subunit 9 family protein [Pop... 89 2e-15 ref|XP_002522486.1| 26S proteasome subunit S9, putative [Ricinus... 87 5e-15 ref|XP_002311105.1| 19S proteosome subunit 9 family protein [Pop... 86 8e-15 ref|XP_007045996.1| 26S proteasome non-ATPase regulatory subunit... 86 1e-14 ref|XP_002315028.1| 19S proteosome subunit 9 family protein [Pop... 85 2e-14 emb|CBI34207.3| unnamed protein product [Vitis vinifera] 84 4e-14 ref|XP_002277010.1| PREDICTED: 26S proteasome non-ATPase regulat... 84 4e-14 ref|XP_006840806.1| hypothetical protein AMTR_s00821p00008410 [A... 83 7e-14 gb|AFK35315.1| unknown [Lotus japonicus] 83 7e-14 ref|XP_004143110.1| PREDICTED: 26S proteasome non-ATPase regulat... 82 2e-13 ref|XP_006348741.1| PREDICTED: 26S proteasome non-ATPase regulat... 80 4e-13 ref|XP_004239103.1| PREDICTED: 26S proteasome non-ATPase regulat... 80 4e-13 ref|XP_004297276.1| PREDICTED: 26S proteasome non-ATPase regulat... 80 8e-13 gb|EPS69667.1| hypothetical protein M569_05097 [Genlisea aurea] 79 1e-12 gb|AFK39481.1| unknown [Medicago truncatula] 79 2e-12 ref|XP_003603578.1| 26S proteasome non-ATPase regulatory subunit... 79 2e-12 ref|XP_006453241.1| hypothetical protein CICLE_v10008409mg [Citr... 77 4e-12 ref|XP_004498550.1| PREDICTED: 26S proteasome non-ATPase regulat... 77 4e-12 >gb|EXC20292.1| 26S proteasome non-ATPase regulatory subunit 11 [Morus notabilis] Length = 425 Score = 90.1 bits (222), Expect = 6e-16 Identities = 46/57 (80%), Positives = 51/57 (89%) Frame = -3 Query: 172 SSAYLPATMDSIDKALEAKDPSESIPLYYRILENPSCSSEALRVKEQAISNLSDLLR 2 SS+YLPAT DSI +ALEAK PSESI + YR+LENPS SSEALR+KEQAISNLSDLLR Sbjct: 4 SSSYLPATTDSIAQALEAKTPSESISILYRVLENPSSSSEALRIKEQAISNLSDLLR 60 >ref|XP_007222547.1| hypothetical protein PRUPE_ppa006204mg [Prunus persica] gi|462419483|gb|EMJ23746.1| hypothetical protein PRUPE_ppa006204mg [Prunus persica] Length = 422 Score = 88.6 bits (218), Expect = 2e-15 Identities = 45/58 (77%), Positives = 52/58 (89%) Frame = -3 Query: 175 MSSAYLPATMDSIDKALEAKDPSESIPLYYRILENPSCSSEALRVKEQAISNLSDLLR 2 MSS+YLPAT DSI +ALEAK PSE+I + YRILENPS SSEALR+KEQAI+NL+DLLR Sbjct: 1 MSSSYLPATTDSIAQALEAKAPSEAISILYRILENPSSSSEALRIKEQAIANLTDLLR 58 >ref|XP_002319533.1| 19S proteosome subunit 9 family protein [Populus trichocarpa] gi|222857909|gb|EEE95456.1| 19S proteosome subunit 9 family protein [Populus trichocarpa] Length = 422 Score = 88.6 bits (218), Expect = 2e-15 Identities = 44/58 (75%), Positives = 51/58 (87%) Frame = -3 Query: 175 MSSAYLPATMDSIDKALEAKDPSESIPLYYRILENPSCSSEALRVKEQAISNLSDLLR 2 MS+ YLPAT DSID+ALEAK+PSE I + YRILENPS S E+LR+KEQAI+NLSDLLR Sbjct: 1 MSTPYLPATTDSIDQALEAKNPSEGISILYRILENPSSSPESLRIKEQAITNLSDLLR 58 >ref|XP_002522486.1| 26S proteasome subunit S9, putative [Ricinus communis] gi|223538371|gb|EEF39978.1| 26S proteasome subunit S9, putative [Ricinus communis] Length = 422 Score = 87.0 bits (214), Expect = 5e-15 Identities = 44/58 (75%), Positives = 50/58 (86%) Frame = -3 Query: 175 MSSAYLPATMDSIDKALEAKDPSESIPLYYRILENPSCSSEALRVKEQAISNLSDLLR 2 MS++YLPAT DSI ALEAK PSESI +YYRILENPS S E+LR+KEQ I+NLSDLLR Sbjct: 1 MSTSYLPATTDSIALALEAKAPSESISIYYRILENPSSSPESLRIKEQVITNLSDLLR 58 >ref|XP_002311105.1| 19S proteosome subunit 9 family protein [Populus trichocarpa] gi|222850925|gb|EEE88472.1| 19S proteosome subunit 9 family protein [Populus trichocarpa] Length = 422 Score = 86.3 bits (212), Expect = 8e-15 Identities = 42/58 (72%), Positives = 53/58 (91%) Frame = -3 Query: 175 MSSAYLPATMDSIDKALEAKDPSESIPLYYRILENPSCSSEALRVKEQAISNLSDLLR 2 MS++YLPAT DSI +ALEAK+PSESI ++YRILE+PS S E+LR+KEQ+I+NLSDLLR Sbjct: 1 MSTSYLPATTDSIAQALEAKNPSESISIFYRILESPSSSPESLRIKEQSITNLSDLLR 58 >ref|XP_007045996.1| 26S proteasome non-ATPase regulatory subunit 11 [Theobroma cacao] gi|508709931|gb|EOY01828.1| 26S proteasome non-ATPase regulatory subunit 11 [Theobroma cacao] Length = 422 Score = 85.5 bits (210), Expect = 1e-14 Identities = 42/58 (72%), Positives = 51/58 (87%) Frame = -3 Query: 175 MSSAYLPATMDSIDKALEAKDPSESIPLYYRILENPSCSSEALRVKEQAISNLSDLLR 2 MSS+YLPAT DSI +ALEAK PSE+I + YR+LENPS + +ALR+KEQAI+NLSDLLR Sbjct: 1 MSSSYLPATTDSIAQALEAKTPSEAISILYRVLENPSSAPDALRIKEQAITNLSDLLR 58 >ref|XP_002315028.1| 19S proteosome subunit 9 family protein [Populus trichocarpa] gi|222864068|gb|EEF01199.1| 19S proteosome subunit 9 family protein [Populus trichocarpa] Length = 422 Score = 84.7 bits (208), Expect = 2e-14 Identities = 42/58 (72%), Positives = 52/58 (89%) Frame = -3 Query: 175 MSSAYLPATMDSIDKALEAKDPSESIPLYYRILENPSCSSEALRVKEQAISNLSDLLR 2 MS+++LPAT DSI +ALEAK+PSE+I +YY ILENPS S E+LR+KEQAI+NLSDLLR Sbjct: 1 MSTSHLPATTDSIAQALEAKNPSEAISIYYIILENPSSSPESLRIKEQAITNLSDLLR 58 >emb|CBI34207.3| unnamed protein product [Vitis vinifera] Length = 298 Score = 84.0 bits (206), Expect = 4e-14 Identities = 40/58 (68%), Positives = 52/58 (89%) Frame = -3 Query: 175 MSSAYLPATMDSIDKALEAKDPSESIPLYYRILENPSCSSEALRVKEQAISNLSDLLR 2 M+S+YLPAT +SI +ALEAK PSE+I + YR+++NPS SSE+LR+KEQAI+NLSDLLR Sbjct: 44 MTSSYLPATTESIAQALEAKTPSEAISILYRVIDNPSSSSESLRIKEQAITNLSDLLR 101 >ref|XP_002277010.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 11 isoform 2 [Vitis vinifera] gi|225451257|ref|XP_002276988.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 11 isoform 1 [Vitis vinifera] gi|359487820|ref|XP_003633654.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 11 [Vitis vinifera] gi|147811910|emb|CAN63723.1| hypothetical protein VITISV_021756 [Vitis vinifera] Length = 422 Score = 84.0 bits (206), Expect = 4e-14 Identities = 40/58 (68%), Positives = 52/58 (89%) Frame = -3 Query: 175 MSSAYLPATMDSIDKALEAKDPSESIPLYYRILENPSCSSEALRVKEQAISNLSDLLR 2 M+S+YLPAT +SI +ALEAK PSE+I + YR+++NPS SSE+LR+KEQAI+NLSDLLR Sbjct: 1 MTSSYLPATTESIAQALEAKTPSEAISILYRVIDNPSSSSESLRIKEQAITNLSDLLR 58 >ref|XP_006840806.1| hypothetical protein AMTR_s00821p00008410 [Amborella trichopoda] gi|548842589|gb|ERN02481.1| hypothetical protein AMTR_s00821p00008410 [Amborella trichopoda] Length = 426 Score = 83.2 bits (204), Expect = 7e-14 Identities = 44/57 (77%), Positives = 47/57 (82%) Frame = -3 Query: 172 SSAYLPATMDSIDKALEAKDPSESIPLYYRILENPSCSSEALRVKEQAISNLSDLLR 2 SS LPAT DSI +ALEAKDPSESI + YRI+ NPS S EALRVKEQ ISNLSDLLR Sbjct: 6 SSGALPATTDSIAEALEAKDPSESISILYRIIANPSSSPEALRVKEQTISNLSDLLR 62 >gb|AFK35315.1| unknown [Lotus japonicus] Length = 422 Score = 83.2 bits (204), Expect = 7e-14 Identities = 41/58 (70%), Positives = 50/58 (86%) Frame = -3 Query: 175 MSSAYLPATMDSIDKALEAKDPSESIPLYYRILENPSCSSEALRVKEQAISNLSDLLR 2 MSS+YLPAT +S+ ALEAKDPSE I + YR+LE+PS S EALR+KEQAI+NL+DLLR Sbjct: 1 MSSSYLPATTESVALALEAKDPSEGISILYRVLEDPSSSPEALRMKEQAITNLTDLLR 58 >ref|XP_004143110.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 11-like isoform 1 [Cucumis sativus] gi|449450722|ref|XP_004143111.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 11-like isoform 2 [Cucumis sativus] gi|449450724|ref|XP_004143112.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 11-like isoform 3 [Cucumis sativus] gi|449529373|ref|XP_004171674.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 11-like isoform 1 [Cucumis sativus] gi|449529375|ref|XP_004171675.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 11-like isoform 2 [Cucumis sativus] gi|449529377|ref|XP_004171676.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 11-like isoform 3 [Cucumis sativus] Length = 422 Score = 81.6 bits (200), Expect = 2e-13 Identities = 40/57 (70%), Positives = 50/57 (87%) Frame = -3 Query: 175 MSSAYLPATMDSIDKALEAKDPSESIPLYYRILENPSCSSEALRVKEQAISNLSDLL 5 MS++YLPAT +SI +ALEAK+ S+SI + YR+LENPS S EALR+KEQAI+NLSDLL Sbjct: 1 MSTSYLPATTESISEALEAKNSSDSISILYRVLENPSSSPEALRIKEQAITNLSDLL 57 >ref|XP_006348741.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 11 homolog [Solanum tuberosum] Length = 423 Score = 80.5 bits (197), Expect = 4e-13 Identities = 41/57 (71%), Positives = 48/57 (84%) Frame = -3 Query: 175 MSSAYLPATMDSIDKALEAKDPSESIPLYYRILENPSCSSEALRVKEQAISNLSDLL 5 M+S+YLPAT DS+ +A EA PSE+I + YRILENPS SSEALR+KEQAI NLSDLL Sbjct: 1 MASSYLPATTDSLAQASEATTPSEAISILYRILENPSSSSEALRIKEQAIFNLSDLL 57 >ref|XP_004239103.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 11-like [Solanum lycopersicum] Length = 423 Score = 80.5 bits (197), Expect = 4e-13 Identities = 41/57 (71%), Positives = 48/57 (84%) Frame = -3 Query: 175 MSSAYLPATMDSIDKALEAKDPSESIPLYYRILENPSCSSEALRVKEQAISNLSDLL 5 M+S+YLPAT DS+ +A EA PSE+I + YRILENPS SSEALR+KEQAI NLSDLL Sbjct: 1 MASSYLPATTDSLAQASEATTPSEAISILYRILENPSSSSEALRIKEQAIFNLSDLL 57 >ref|XP_004297276.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 11-like [Fragaria vesca subsp. vesca] Length = 422 Score = 79.7 bits (195), Expect = 8e-13 Identities = 41/58 (70%), Positives = 49/58 (84%) Frame = -3 Query: 175 MSSAYLPATMDSIDKALEAKDPSESIPLYYRILENPSCSSEALRVKEQAISNLSDLLR 2 MS++YLPAT DSI A EAK PSE I + YRILE+PS SSEALR+KEQAI++L+DLLR Sbjct: 1 MSTSYLPATKDSIALASEAKAPSEGIAILYRILEDPSTSSEALRIKEQAITDLADLLR 58 >gb|EPS69667.1| hypothetical protein M569_05097 [Genlisea aurea] Length = 423 Score = 79.0 bits (193), Expect = 1e-12 Identities = 39/58 (67%), Positives = 50/58 (86%) Frame = -3 Query: 175 MSSAYLPATMDSIDKALEAKDPSESIPLYYRILENPSCSSEALRVKEQAISNLSDLLR 2 MSS+YLPAT +S+ +A EAK P+E+I + Y ILE+PS SSEALR+KEQAI+NLSD+LR Sbjct: 1 MSSSYLPATTESLFQAAEAKTPAEAISILYGILESPSSSSEALRIKEQAITNLSDILR 58 >gb|AFK39481.1| unknown [Medicago truncatula] Length = 244 Score = 78.6 bits (192), Expect = 2e-12 Identities = 39/58 (67%), Positives = 50/58 (86%) Frame = -3 Query: 175 MSSAYLPATMDSIDKALEAKDPSESIPLYYRILENPSCSSEALRVKEQAISNLSDLLR 2 MS++YLPAT DSI +ALEAKD S +I + YR+L++PS S EALR+KEQAI+NL+DLLR Sbjct: 1 MSTSYLPATTDSIAQALEAKDTSGAISILYRVLDDPSSSPEALRMKEQAITNLTDLLR 58 >ref|XP_003603578.1| 26S proteasome non-ATPase regulatory subunit [Medicago truncatula] gi|355492626|gb|AES73829.1| 26S proteasome non-ATPase regulatory subunit [Medicago truncatula] Length = 671 Score = 78.6 bits (192), Expect = 2e-12 Identities = 39/58 (67%), Positives = 50/58 (86%) Frame = -3 Query: 175 MSSAYLPATMDSIDKALEAKDPSESIPLYYRILENPSCSSEALRVKEQAISNLSDLLR 2 MS++YLPAT DSI +ALEAKD S +I + YR+L++PS S EALR+KEQAI+NL+DLLR Sbjct: 250 MSTSYLPATTDSIAQALEAKDTSGAISILYRVLDDPSSSPEALRMKEQAITNLTDLLR 307 >ref|XP_006453241.1| hypothetical protein CICLE_v10008409mg [Citrus clementina] gi|568840645|ref|XP_006474276.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 11 homolog [Citrus sinensis] gi|557556467|gb|ESR66481.1| hypothetical protein CICLE_v10008409mg [Citrus clementina] Length = 422 Score = 77.4 bits (189), Expect = 4e-12 Identities = 39/58 (67%), Positives = 49/58 (84%) Frame = -3 Query: 175 MSSAYLPATMDSIDKALEAKDPSESIPLYYRILENPSCSSEALRVKEQAISNLSDLLR 2 MSS+YLPAT DSI +A EA +PS++I + YR+L++PS SSEALRVKE AI+ LSDLLR Sbjct: 1 MSSSYLPATTDSIAQAKEASNPSDAISMLYRVLDDPSSSSEALRVKELAITELSDLLR 58 >ref|XP_004498550.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 11-like [Cicer arietinum] Length = 421 Score = 77.4 bits (189), Expect = 4e-12 Identities = 38/56 (67%), Positives = 49/56 (87%) Frame = -3 Query: 169 SAYLPATMDSIDKALEAKDPSESIPLYYRILENPSCSSEALRVKEQAISNLSDLLR 2 S++LPAT +SI +ALEAKDPSE+I + YR+L +PS S EALR+KEQAI+NL+DLLR Sbjct: 2 SSFLPATTESIAQALEAKDPSEAISILYRVLGDPSSSPEALRMKEQAITNLTDLLR 57