BLASTX nr result
ID: Papaver25_contig00032436
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00032436 (520 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002876892.1| hypothetical protein ARALYDRAFT_904655 [Arab... 60 3e-07 >ref|XP_002876892.1| hypothetical protein ARALYDRAFT_904655 [Arabidopsis lyrata subsp. lyrata] gi|297322730|gb|EFH53151.1| hypothetical protein ARALYDRAFT_904655 [Arabidopsis lyrata subsp. lyrata] Length = 74 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/48 (64%), Positives = 35/48 (72%) Frame = -2 Query: 438 VVGAAILGLVIYLFSGNNRKTMKAPGKDGRMLRNDFEKDPTSYFRNLR 295 VVGA I GL + SG N+KTMKAPGKDGR+ R FE DP YFRN+R Sbjct: 26 VVGA-IAGLFSGMGSGPNKKTMKAPGKDGRIFREVFESDPKGYFRNMR 72