BLASTX nr result
ID: Papaver25_contig00032320
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00032320 (467 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004139175.1| PREDICTED: probable Xaa-Pro aminopeptidase P... 56 5e-06 ref|XP_004156420.1| PREDICTED: LOW QUALITY PROTEIN: probable Xaa... 55 8e-06 >ref|XP_004139175.1| PREDICTED: probable Xaa-Pro aminopeptidase P-like [Cucumis sativus] Length = 709 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/40 (67%), Positives = 30/40 (75%), Gaps = 4/40 (10%) Frame = +1 Query: 358 NTPNHLEGIGYLGFEDITLVPIQAK----PLMSAAEVNWL 465 NTPNH GIGYLGFE +T VPIQ K L+SA+EVNWL Sbjct: 637 NTPNHFGGIGYLGFEKLTFVPIQTKLVDITLLSASEVNWL 676 >ref|XP_004156420.1| PREDICTED: LOW QUALITY PROTEIN: probable Xaa-Pro aminopeptidase P-like [Cucumis sativus] Length = 710 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/40 (67%), Positives = 30/40 (75%), Gaps = 4/40 (10%) Frame = +1 Query: 358 NTPNHLEGIGYLGFEDITLVPIQAK----PLMSAAEVNWL 465 +TPNH GIGYLGFE +T VPIQ K L+SAAEVNWL Sbjct: 638 DTPNHFGGIGYLGFEKLTFVPIQTKLVDITLLSAAEVNWL 677