BLASTX nr result
ID: Papaver25_contig00032008
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00032008 (1143 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002965176.1| hypothetical protein SELMODRAFT_167230 [Sela... 58 9e-06 ref|NP_192893.2| bromo-adjacent homology (BAH) domain-containing... 58 9e-06 emb|CAB78199.1| putative protein [Arabidopsis thaliana] gi|73210... 58 9e-06 >ref|XP_002965176.1| hypothetical protein SELMODRAFT_167230 [Selaginella moellendorffii] gi|300167409|gb|EFJ34014.1| hypothetical protein SELMODRAFT_167230 [Selaginella moellendorffii] Length = 360 Score = 57.8 bits (138), Expect = 9e-06 Identities = 38/105 (36%), Positives = 57/105 (54%), Gaps = 8/105 (7%) Frame = +1 Query: 7 LMHPCIVRFVP*VDKIPVRTLNPGFIVLRVNEQEEQVLCWIPDRAFVKHKQVEIDCLLLK 186 +MH C+V F+P K P R+L+PGFIV +V + E+ L + D+ + KQ EID L+ K Sbjct: 109 VMHKCVVHFIPSHKKSPPRSLHPGFIVRKVYDTVEKKLWNLTDKDYEDAKQKEIDLLVQK 168 Query: 187 TQQV*G--DNTEMEEGIRPHVPVYDT------SDVDAILECSKLL 297 T + G + E+EE P V + DV+A+L +L Sbjct: 169 THKALGGLQDAEVEEVETPSVAKVEAVTPGADGDVNAMLRQMNVL 213 >ref|NP_192893.2| bromo-adjacent homology (BAH) domain-containing protein [Arabidopsis thaliana] gi|19347810|gb|AAL86355.1| unknown protein [Arabidopsis thaliana] gi|22136724|gb|AAM91681.1| unknown protein [Arabidopsis thaliana] gi|332657624|gb|AEE83024.1| bromo-adjacent homology (BAH) domain-containing protein [Arabidopsis thaliana] Length = 587 Score = 57.8 bits (138), Expect = 9e-06 Identities = 31/72 (43%), Positives = 44/72 (61%) Frame = +1 Query: 7 LMHPCIVRFVP*VDKIPVRTLNPGFIVLRVNEQEEQVLCWIPDRAFVKHKQVEIDCLLLK 186 +MH C+V FVP ++P R NPGFIV +V + E+ L + D+ + KQ EID L+ K Sbjct: 207 VMHRCVVYFVPAHKQLPKRKNNPGFIVRKVYDTVEKKLWKLTDKDYEDSKQREIDVLVKK 266 Query: 187 TQQV*GDNTEME 222 T V GD ++E Sbjct: 267 TMNVLGDLPDLE 278 >emb|CAB78199.1| putative protein [Arabidopsis thaliana] gi|7321053|emb|CAB82161.1| putative protein [Arabidopsis thaliana] Length = 652 Score = 57.8 bits (138), Expect = 9e-06 Identities = 31/72 (43%), Positives = 44/72 (61%) Frame = +1 Query: 7 LMHPCIVRFVP*VDKIPVRTLNPGFIVLRVNEQEEQVLCWIPDRAFVKHKQVEIDCLLLK 186 +MH C+V FVP ++P R NPGFIV +V + E+ L + D+ + KQ EID L+ K Sbjct: 293 VMHRCVVYFVPAHKQLPKRKNNPGFIVRKVYDTVEKKLWKLTDKDYEDSKQREIDVLVKK 352 Query: 187 TQQV*GDNTEME 222 T V GD ++E Sbjct: 353 TMNVLGDLPDLE 364