BLASTX nr result
ID: Papaver25_contig00031987
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00031987 (466 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI21361.3| unnamed protein product [Vitis vinifera] 63 5e-08 ref|NP_001268190.1| uncharacterized protein LOC100260066 [Vitis ... 63 5e-08 emb|CAN82189.1| hypothetical protein VITISV_031114 [Vitis vinifera] 63 5e-08 ref|XP_006604142.1| PREDICTED: chloride channel protein CLC-b-li... 62 1e-07 ref|XP_007161742.1| hypothetical protein PHAVU_001G094700g [Phas... 62 1e-07 ref|XP_007161741.1| hypothetical protein PHAVU_001G094700g [Phas... 62 1e-07 ref|XP_007151531.1| hypothetical protein PHAVU_004G054600g [Phas... 62 1e-07 ref|XP_006447084.1| hypothetical protein CICLE_v10014341mg [Citr... 62 1e-07 ref|XP_007031850.1| Chloride channel B isoform 4, partial [Theob... 62 1e-07 ref|XP_007031848.1| Chloride channel B isoform 2 [Theobroma caca... 62 1e-07 ref|XP_004513192.1| PREDICTED: chloride channel protein CLC-b-li... 62 1e-07 ref|XP_004303984.1| PREDICTED: chloride channel protein CLC-b-li... 62 1e-07 gb|AAD29679.1|AF133209_1 CLC-Nt2 protein [Nicotiana tabacum] 62 1e-07 ref|XP_003553925.1| PREDICTED: chloride channel protein CLC-b-li... 62 1e-07 ref|NP_001236494.1| chloride channel [Glycine max] gi|66220164|g... 62 1e-07 ref|NP_001267676.1| chloride channel protein CLC-b-like [Cucumis... 61 1e-07 ref|XP_003618847.1| Chloride channel protein CLC-a [Medicago tru... 61 1e-07 ref|XP_002509531.1| chloride channel clc, putative [Ricinus comm... 61 1e-07 ref|NP_189353.1| chloride channel protein CLC-b [Arabidopsis tha... 61 2e-07 ref|XP_006395477.1| hypothetical protein EUTSA_v10003679mg [Eutr... 61 2e-07 >emb|CBI21361.3| unnamed protein product [Vitis vinifera] Length = 789 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 1 AAGPGIPEIKAYLNGVDTPNMYGASTLIVK 90 AAGPGIPEIKAYLNGVDTPNM+GASTLIVK Sbjct: 164 AAGPGIPEIKAYLNGVDTPNMFGASTLIVK 193 >ref|NP_001268190.1| uncharacterized protein LOC100260066 [Vitis vinifera] gi|301318134|gb|ADK66982.1| chloride channel ClC4 [Vitis vinifera] Length = 789 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 1 AAGPGIPEIKAYLNGVDTPNMYGASTLIVK 90 AAGPGIPEIKAYLNGVDTPNM+GASTLIVK Sbjct: 164 AAGPGIPEIKAYLNGVDTPNMFGASTLIVK 193 >emb|CAN82189.1| hypothetical protein VITISV_031114 [Vitis vinifera] Length = 753 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 1 AAGPGIPEIKAYLNGVDTPNMYGASTLIVK 90 AAGPGIPEIKAYLNGVDTPNM+GASTLIVK Sbjct: 159 AAGPGIPEIKAYLNGVDTPNMFGASTLIVK 188 >ref|XP_006604142.1| PREDICTED: chloride channel protein CLC-b-like isoform X2 [Glycine max] Length = 780 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 1 AAGPGIPEIKAYLNGVDTPNMYGASTLIVK 90 AAGPGIPEIKAYLNGVDTPNM+GA+TLIVK Sbjct: 163 AAGPGIPEIKAYLNGVDTPNMFGATTLIVK 192 >ref|XP_007161742.1| hypothetical protein PHAVU_001G094700g [Phaseolus vulgaris] gi|561035206|gb|ESW33736.1| hypothetical protein PHAVU_001G094700g [Phaseolus vulgaris] Length = 791 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 1 AAGPGIPEIKAYLNGVDTPNMYGASTLIVK 90 AAGPGIPEIKAYLNGVDTPNM+GA+TLIVK Sbjct: 163 AAGPGIPEIKAYLNGVDTPNMFGATTLIVK 192 >ref|XP_007161741.1| hypothetical protein PHAVU_001G094700g [Phaseolus vulgaris] gi|561035205|gb|ESW33735.1| hypothetical protein PHAVU_001G094700g [Phaseolus vulgaris] Length = 742 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 1 AAGPGIPEIKAYLNGVDTPNMYGASTLIVK 90 AAGPGIPEIKAYLNGVDTPNM+GA+TLIVK Sbjct: 163 AAGPGIPEIKAYLNGVDTPNMFGATTLIVK 192 >ref|XP_007151531.1| hypothetical protein PHAVU_004G054600g [Phaseolus vulgaris] gi|561024840|gb|ESW23525.1| hypothetical protein PHAVU_004G054600g [Phaseolus vulgaris] Length = 782 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 1 AAGPGIPEIKAYLNGVDTPNMYGASTLIVK 90 AAGPGIPEIKAYLNGVDTPNMYGA+TL VK Sbjct: 161 AAGPGIPEIKAYLNGVDTPNMYGATTLFVK 190 >ref|XP_006447084.1| hypothetical protein CICLE_v10014341mg [Citrus clementina] gi|568831589|ref|XP_006470044.1| PREDICTED: chloride channel protein CLC-b-like [Citrus sinensis] gi|557549695|gb|ESR60324.1| hypothetical protein CICLE_v10014341mg [Citrus clementina] Length = 783 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 1 AAGPGIPEIKAYLNGVDTPNMYGASTLIVK 90 AAGPGIPEIKAYLNGVDTPNM+GA+TLIVK Sbjct: 159 AAGPGIPEIKAYLNGVDTPNMFGATTLIVK 188 >ref|XP_007031850.1| Chloride channel B isoform 4, partial [Theobroma cacao] gi|508710879|gb|EOY02776.1| Chloride channel B isoform 4, partial [Theobroma cacao] Length = 799 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 1 AAGPGIPEIKAYLNGVDTPNMYGASTLIVK 90 AAGPGIPEIKAYLNGVDTPNM+GA+TLIVK Sbjct: 160 AAGPGIPEIKAYLNGVDTPNMFGATTLIVK 189 >ref|XP_007031848.1| Chloride channel B isoform 2 [Theobroma cacao] gi|508710877|gb|EOY02774.1| Chloride channel B isoform 2 [Theobroma cacao] Length = 787 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 1 AAGPGIPEIKAYLNGVDTPNMYGASTLIVK 90 AAGPGIPEIKAYLNGVDTPNM+GA+TLIVK Sbjct: 162 AAGPGIPEIKAYLNGVDTPNMFGATTLIVK 191 >ref|XP_004513192.1| PREDICTED: chloride channel protein CLC-b-like [Cicer arietinum] Length = 792 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 1 AAGPGIPEIKAYLNGVDTPNMYGASTLIVK 90 AAGPGIPEIKAYLNGVDTPNM+GA+TLIVK Sbjct: 162 AAGPGIPEIKAYLNGVDTPNMFGATTLIVK 191 >ref|XP_004303984.1| PREDICTED: chloride channel protein CLC-b-like [Fragaria vesca subsp. vesca] Length = 790 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 1 AAGPGIPEIKAYLNGVDTPNMYGASTLIVK 90 AAGPGIPEIKAYLNGVDTPNM+GA+TLIVK Sbjct: 164 AAGPGIPEIKAYLNGVDTPNMFGATTLIVK 193 >gb|AAD29679.1|AF133209_1 CLC-Nt2 protein [Nicotiana tabacum] Length = 786 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 1 AAGPGIPEIKAYLNGVDTPNMYGASTLIVK 90 AAGPGIPEIKAYLNGVDTPNMYGA+TL VK Sbjct: 161 AAGPGIPEIKAYLNGVDTPNMYGATTLFVK 190 >ref|XP_003553925.1| PREDICTED: chloride channel protein CLC-b-like isoform X1 [Glycine max] Length = 790 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 1 AAGPGIPEIKAYLNGVDTPNMYGASTLIVK 90 AAGPGIPEIKAYLNGVDTPNM+GA+TLIVK Sbjct: 163 AAGPGIPEIKAYLNGVDTPNMFGATTLIVK 192 >ref|NP_001236494.1| chloride channel [Glycine max] gi|66220164|gb|AAY43007.1| chloride channel [Glycine max] Length = 783 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 1 AAGPGIPEIKAYLNGVDTPNMYGASTLIVK 90 AAGPGIPEIKAYLNGVDTPNMYGA+TL VK Sbjct: 162 AAGPGIPEIKAYLNGVDTPNMYGATTLFVK 191 >ref|NP_001267676.1| chloride channel protein CLC-b-like [Cucumis sativus] gi|386649465|gb|AFJ15538.1| chloride channel a [Cucumis sativus] Length = 789 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 1 AAGPGIPEIKAYLNGVDTPNMYGASTLIVK 90 AAGPGIPEIKAYLNG+DTPNM+GA+TLIVK Sbjct: 162 AAGPGIPEIKAYLNGIDTPNMFGATTLIVK 191 >ref|XP_003618847.1| Chloride channel protein CLC-a [Medicago truncatula] gi|355493862|gb|AES75065.1| Chloride channel protein CLC-a [Medicago truncatula] Length = 780 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +1 Query: 1 AAGPGIPEIKAYLNGVDTPNMYGASTLIVKAS 96 AAGPGIPEIKAYLNGVDTPNMYGA+ L VK S Sbjct: 157 AAGPGIPEIKAYLNGVDTPNMYGATVLFVKVS 188 >ref|XP_002509531.1| chloride channel clc, putative [Ricinus communis] gi|223549430|gb|EEF50918.1| chloride channel clc, putative [Ricinus communis] Length = 787 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 1 AAGPGIPEIKAYLNGVDTPNMYGASTLIVK 90 AAGPGIPEIKAYLNG+DTPNM+GA+TLIVK Sbjct: 162 AAGPGIPEIKAYLNGIDTPNMFGATTLIVK 191 >ref|NP_189353.1| chloride channel protein CLC-b [Arabidopsis thaliana] gi|41688457|sp|P92942.1|CLCB_ARATH RecName: Full=Chloride channel protein CLC-b; Short=AtCLC-b; AltName: Full=CBS domain-containing protein CBSCLC7 gi|1742955|emb|CAA96058.1| CLC-b chloride channel protein [Arabidopsis thaliana] gi|9294082|dbj|BAB01934.1| CLC-d chloride channel; anion channel protein [Arabidopsis thaliana] gi|17064884|gb|AAL32596.1| CLC-d chloride channel; anion channel protein [Arabidopsis thaliana] gi|332643754|gb|AEE77275.1| chloride channel protein CLC-b [Arabidopsis thaliana] Length = 780 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 1 AAGPGIPEIKAYLNGVDTPNMYGASTLIVK 90 AAGPGIPEIKAYLNGVDTPNM+GA+T+IVK Sbjct: 156 AAGPGIPEIKAYLNGVDTPNMFGATTMIVK 185 >ref|XP_006395477.1| hypothetical protein EUTSA_v10003679mg [Eutrema salsugineum] gi|557092116|gb|ESQ32763.1| hypothetical protein EUTSA_v10003679mg [Eutrema salsugineum] Length = 778 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 1 AAGPGIPEIKAYLNGVDTPNMYGASTLIVK 90 AAGPGIPEIKAYLNGVDTPNM+GA+T+IVK Sbjct: 154 AAGPGIPEIKAYLNGVDTPNMFGATTMIVK 183