BLASTX nr result
ID: Papaver25_contig00031969
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00031969 (780 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007016944.1| Tetratricopeptide repeat (TPR)-containing pr... 69 2e-09 ref|XP_006401070.1| hypothetical protein EUTSA_v10012604mg [Eutr... 67 7e-09 sp|Q9LV01.2|ETOL2_ARATH RecName: Full=ETO1-like protein 2; AltNa... 67 9e-09 ref|NP_200663.2| protein ETO1-like 2 [Arabidopsis thaliana] gi|3... 67 9e-09 ref|XP_002269998.1| PREDICTED: ethylene-overproduction protein 1... 66 1e-08 ref|XP_006488564.1| PREDICTED: ethylene-overproduction protein 1... 65 2e-08 ref|XP_002278414.1| PREDICTED: ethylene-overproduction protein 1... 65 2e-08 ref|XP_006279969.1| hypothetical protein CARUB_v10025836mg [Caps... 64 5e-08 ref|XP_006425117.1| hypothetical protein CICLE_v10030370mg [Citr... 64 6e-08 ref|XP_006369672.1| hypothetical protein POPTR_0001s287002g, par... 64 6e-08 ref|XP_002866273.1| hypothetical protein ARALYDRAFT_495977 [Arab... 64 6e-08 ref|XP_007208376.1| hypothetical protein PRUPE_ppa000874mg [Prun... 64 8e-08 ref|XP_007208715.1| hypothetical protein PRUPE_ppa001036mg [Prun... 63 1e-07 ref|XP_002521192.1| Ethylene-overproduction protein, putative [R... 63 1e-07 gb|AAC14404.1| unknown [Arabidopsis thaliana] 62 2e-07 ref|XP_006481087.1| PREDICTED: ethylene-overproduction protein 1... 62 2e-07 ref|XP_006429462.1| hypothetical protein CICLE_v10010996mg [Citr... 62 2e-07 sp|O65020.2|ETO1_ARATH RecName: Full=Ethylene-overproduction pro... 62 2e-07 ref|NP_001030839.5| Ethylene-overproduction protein 1 [Arabidops... 62 2e-07 ref|NP_190745.6| Ethylene-overproduction protein 1 [Arabidopsis ... 62 2e-07 >ref|XP_007016944.1| Tetratricopeptide repeat (TPR)-containing protein [Theobroma cacao] gi|508787307|gb|EOY34563.1| Tetratricopeptide repeat (TPR)-containing protein [Theobroma cacao] Length = 938 Score = 68.9 bits (167), Expect = 2e-09 Identities = 30/50 (60%), Positives = 40/50 (80%) Frame = +2 Query: 629 LLPFGLPRTALLEPPIEPYLKSVNLVESLANVYKRLESCSSEEKSMVFLE 778 LLPFGLPR LLEPPIEP+ K + LVE+LA++Y+R E+C EKS++ +E Sbjct: 64 LLPFGLPRADLLEPPIEPHSKQIQLVETLADLYRRFETCLESEKSLICIE 113 >ref|XP_006401070.1| hypothetical protein EUTSA_v10012604mg [Eutrema salsugineum] gi|557102160|gb|ESQ42523.1| hypothetical protein EUTSA_v10012604mg [Eutrema salsugineum] Length = 928 Score = 67.0 bits (162), Expect = 7e-09 Identities = 30/50 (60%), Positives = 40/50 (80%) Frame = +2 Query: 629 LLPFGLPRTALLEPPIEPYLKSVNLVESLANVYKRLESCSSEEKSMVFLE 778 LLP G P T LLEPP++ YLK ++LVESL+N+Y+R+ES S E SM++LE Sbjct: 51 LLPHGFPTTELLEPPLDSYLKPIDLVESLSNLYRRIESSSESETSMLYLE 100 >sp|Q9LV01.2|ETOL2_ARATH RecName: Full=ETO1-like protein 2; AltName: Full=Ethylene overproducer 1-like protein 2 gi|46810687|gb|AAT01658.1| ethylene overproducer 1-like 2 [Arabidopsis thaliana] Length = 925 Score = 66.6 bits (161), Expect = 9e-09 Identities = 30/50 (60%), Positives = 40/50 (80%) Frame = +2 Query: 629 LLPFGLPRTALLEPPIEPYLKSVNLVESLANVYKRLESCSSEEKSMVFLE 778 LLP G P T LLEPP++ YLK ++LVESL+N+Y+R+ES S E SM++LE Sbjct: 48 LLPHGFPTTDLLEPPLDSYLKPIDLVESLSNLYRRIESSSESEASMLYLE 97 >ref|NP_200663.2| protein ETO1-like 2 [Arabidopsis thaliana] gi|332009684|gb|AED97067.1| protein ETO1-like 2 [Arabidopsis thaliana] Length = 925 Score = 66.6 bits (161), Expect = 9e-09 Identities = 30/50 (60%), Positives = 40/50 (80%) Frame = +2 Query: 629 LLPFGLPRTALLEPPIEPYLKSVNLVESLANVYKRLESCSSEEKSMVFLE 778 LLP G P T LLEPP++ YLK ++LVESL+N+Y+R+ES S E SM++LE Sbjct: 48 LLPHGFPTTDLLEPPLDSYLKPIDLVESLSNLYRRIESSSESEASMLYLE 97 >ref|XP_002269998.1| PREDICTED: ethylene-overproduction protein 1-like [Vitis vinifera] Length = 951 Score = 66.2 bits (160), Expect = 1e-08 Identities = 32/50 (64%), Positives = 38/50 (76%) Frame = +2 Query: 629 LLPFGLPRTALLEPPIEPYLKSVNLVESLANVYKRLESCSSEEKSMVFLE 778 LLP GLP+ LLEP IEPYLKSVN VE+LA+VY+R +C EKS +LE Sbjct: 83 LLPHGLPKADLLEPQIEPYLKSVNFVETLADVYRRTANCLQFEKSEAYLE 132 >ref|XP_006488564.1| PREDICTED: ethylene-overproduction protein 1-like isoform X1 [Citrus sinensis] Length = 929 Score = 65.5 bits (158), Expect = 2e-08 Identities = 28/50 (56%), Positives = 41/50 (82%) Frame = +2 Query: 629 LLPFGLPRTALLEPPIEPYLKSVNLVESLANVYKRLESCSSEEKSMVFLE 778 LLP+GLP T LLEP I+P+LK ++ V+SLA++Y+R E+C +KSM+F+E Sbjct: 62 LLPYGLPSTDLLEPSIDPHLKPIHCVKSLADLYRRFETCLESDKSMLFIE 111 >ref|XP_002278414.1| PREDICTED: ethylene-overproduction protein 1-like [Vitis vinifera] Length = 927 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/50 (58%), Positives = 42/50 (84%) Frame = +2 Query: 629 LLPFGLPRTALLEPPIEPYLKSVNLVESLANVYKRLESCSSEEKSMVFLE 778 LLP+GLP T L+EPPI+ +LKSVN VE+LA++Y+R ++CS +KS++ LE Sbjct: 58 LLPYGLPTTELIEPPIDLHLKSVNHVETLASLYRRFQTCSQFDKSLICLE 107 >ref|XP_006279969.1| hypothetical protein CARUB_v10025836mg [Capsella rubella] gi|565431404|ref|XP_006279970.1| hypothetical protein CARUB_v10025836mg [Capsella rubella] gi|482548673|gb|EOA12867.1| hypothetical protein CARUB_v10025836mg [Capsella rubella] gi|482548674|gb|EOA12868.1| hypothetical protein CARUB_v10025836mg [Capsella rubella] Length = 929 Score = 64.3 bits (155), Expect = 5e-08 Identities = 30/50 (60%), Positives = 39/50 (78%) Frame = +2 Query: 629 LLPFGLPRTALLEPPIEPYLKSVNLVESLANVYKRLESCSSEEKSMVFLE 778 LLP G P T LLEP +E YLK ++LVESL+N+Y+R+ES S E SM++LE Sbjct: 51 LLPHGFPTTELLEPLLESYLKPIDLVESLSNLYRRIESASEPETSMLYLE 100 >ref|XP_006425117.1| hypothetical protein CICLE_v10030370mg [Citrus clementina] gi|557527051|gb|ESR38357.1| hypothetical protein CICLE_v10030370mg [Citrus clementina] Length = 914 Score = 63.9 bits (154), Expect = 6e-08 Identities = 27/50 (54%), Positives = 40/50 (80%) Frame = +2 Query: 629 LLPFGLPRTALLEPPIEPYLKSVNLVESLANVYKRLESCSSEEKSMVFLE 778 LLP+GLP T LLEP I+P+LK + V++LA++Y+R E+C +KSM+F+E Sbjct: 62 LLPYGLPSTDLLEPSIDPHLKPIQCVKALADLYRRFETCLESDKSMLFIE 111 >ref|XP_006369672.1| hypothetical protein POPTR_0001s287002g, partial [Populus trichocarpa] gi|550348402|gb|ERP66241.1| hypothetical protein POPTR_0001s287002g, partial [Populus trichocarpa] Length = 270 Score = 63.9 bits (154), Expect = 6e-08 Identities = 28/50 (56%), Positives = 40/50 (80%) Frame = +2 Query: 629 LLPFGLPRTALLEPPIEPYLKSVNLVESLANVYKRLESCSSEEKSMVFLE 778 LLP+GLP T LLEPPI+ YLK ++ VESLA +++RL +CS +KS++ +E Sbjct: 50 LLPYGLPTTELLEPPIDSYLKPIDYVESLAEIHRRLNTCSLTDKSILCIE 99 >ref|XP_002866273.1| hypothetical protein ARALYDRAFT_495977 [Arabidopsis lyrata subsp. lyrata] gi|297312108|gb|EFH42532.1| hypothetical protein ARALYDRAFT_495977 [Arabidopsis lyrata subsp. lyrata] Length = 925 Score = 63.9 bits (154), Expect = 6e-08 Identities = 30/50 (60%), Positives = 39/50 (78%) Frame = +2 Query: 629 LLPFGLPRTALLEPPIEPYLKSVNLVESLANVYKRLESCSSEEKSMVFLE 778 LLP G P T LLEP +E YLK ++LVESL+N+Y+R+ES S E SM++LE Sbjct: 48 LLPHGFPTTDLLEPLLESYLKPIDLVESLSNLYRRIESSSQSETSMLYLE 97 >ref|XP_007208376.1| hypothetical protein PRUPE_ppa000874mg [Prunus persica] gi|462404018|gb|EMJ09575.1| hypothetical protein PRUPE_ppa000874mg [Prunus persica] Length = 974 Score = 63.5 bits (153), Expect = 8e-08 Identities = 29/50 (58%), Positives = 40/50 (80%) Frame = +2 Query: 629 LLPFGLPRTALLEPPIEPYLKSVNLVESLANVYKRLESCSSEEKSMVFLE 778 LLP+GLP + LLEP IEP LKSV+ VE+LA+VY+R++ C EKS +++E Sbjct: 88 LLPYGLPSSDLLEPQIEPSLKSVDFVETLADVYRRIDHCPQFEKSKMYME 137 >ref|XP_007208715.1| hypothetical protein PRUPE_ppa001036mg [Prunus persica] gi|462404357|gb|EMJ09914.1| hypothetical protein PRUPE_ppa001036mg [Prunus persica] Length = 927 Score = 63.2 bits (152), Expect = 1e-07 Identities = 35/92 (38%), Positives = 55/92 (59%), Gaps = 5/92 (5%) Frame = +2 Query: 518 TEDKQQHSTISQ----NHCVRAVNNXXXXXXXXXXXXXDNLLLPFGLPRTALLEPPIEPY 685 T + + H +S+ +H +++ + + LLLP+GLP T LLEP IEP+ Sbjct: 23 TSNGKTHVGVSRAKLNSHLIKSFGSNSKPKSFNSLSVTEALLLPYGLPATDLLEPSIEPH 82 Query: 686 LKSVNLVESLANVYKRLESCSSE-EKSMVFLE 778 LK VE LA++Y RLE+CSS+ +KS++ +E Sbjct: 83 LKPTEFVEILADLYHRLENCSSQSDKSLLSIE 114 >ref|XP_002521192.1| Ethylene-overproduction protein, putative [Ricinus communis] gi|223539606|gb|EEF41192.1| Ethylene-overproduction protein, putative [Ricinus communis] Length = 911 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/52 (55%), Positives = 39/52 (75%) Frame = +2 Query: 623 NLLLPFGLPRTALLEPPIEPYLKSVNLVESLANVYKRLESCSSEEKSMVFLE 778 + LLP+GLP T LLEP I+P+LK V VESLA +Y+RL SC +KS++ +E Sbjct: 39 HFLLPYGLPTTDLLEPTIDPHLKPVYYVESLAELYRRLNSCLQSDKSLLCIE 90 >gb|AAC14404.1| unknown [Arabidopsis thaliana] Length = 958 Score = 62.4 bits (150), Expect = 2e-07 Identities = 31/50 (62%), Positives = 38/50 (76%) Frame = +2 Query: 629 LLPFGLPRTALLEPPIEPYLKSVNLVESLANVYKRLESCSSEEKSMVFLE 778 LLP GLP T LLEP I+P LK V+LVE +A VY+R+E+CS EKS +LE Sbjct: 97 LLPCGLPVTDLLEPQIDPCLKFVDLVEKMAQVYRRIENCSQFEKSGAYLE 146 >ref|XP_006481087.1| PREDICTED: ethylene-overproduction protein 1-like [Citrus sinensis] Length = 967 Score = 62.4 bits (150), Expect = 2e-07 Identities = 30/50 (60%), Positives = 39/50 (78%) Frame = +2 Query: 629 LLPFGLPRTALLEPPIEPYLKSVNLVESLANVYKRLESCSSEEKSMVFLE 778 +LP+GLP T LLEP IEP LK V+ VE+LA++Y+R+E C EKS V+LE Sbjct: 99 VLPYGLPITDLLEPQIEPCLKFVDFVETLADLYRRIEDCPQFEKSGVYLE 148 >ref|XP_006429462.1| hypothetical protein CICLE_v10010996mg [Citrus clementina] gi|557531519|gb|ESR42702.1| hypothetical protein CICLE_v10010996mg [Citrus clementina] Length = 967 Score = 62.4 bits (150), Expect = 2e-07 Identities = 30/50 (60%), Positives = 39/50 (78%) Frame = +2 Query: 629 LLPFGLPRTALLEPPIEPYLKSVNLVESLANVYKRLESCSSEEKSMVFLE 778 +LP+GLP T LLEP IEP LK V+ VE+LA++Y+R+E C EKS V+LE Sbjct: 99 VLPYGLPITDLLEPQIEPCLKFVDFVETLADLYRRIEDCPQFEKSGVYLE 148 >sp|O65020.2|ETO1_ARATH RecName: Full=Ethylene-overproduction protein 1; AltName: Full=Protein ETHYLENE OVERPRODUCER 1; Short=Protein ETO1 gi|46810683|gb|AAT01656.1| ethylene overproducer 1 [Arabidopsis thaliana] Length = 951 Score = 62.4 bits (150), Expect = 2e-07 Identities = 31/50 (62%), Positives = 38/50 (76%) Frame = +2 Query: 629 LLPFGLPRTALLEPPIEPYLKSVNLVESLANVYKRLESCSSEEKSMVFLE 778 LLP GLP T LLEP I+P LK V+LVE +A VY+R+E+CS EKS +LE Sbjct: 89 LLPCGLPVTDLLEPQIDPCLKFVDLVEKMAQVYRRIENCSQFEKSGAYLE 138 >ref|NP_001030839.5| Ethylene-overproduction protein 1 [Arabidopsis thaliana] gi|332645320|gb|AEE78841.1| Ethylene-overproduction protein 1 [Arabidopsis thaliana] Length = 959 Score = 62.4 bits (150), Expect = 2e-07 Identities = 31/50 (62%), Positives = 38/50 (76%) Frame = +2 Query: 629 LLPFGLPRTALLEPPIEPYLKSVNLVESLANVYKRLESCSSEEKSMVFLE 778 LLP GLP T LLEP I+P LK V+LVE +A VY+R+E+CS EKS +LE Sbjct: 97 LLPCGLPVTDLLEPQIDPCLKFVDLVEKMAQVYRRIENCSQFEKSGAYLE 146 >ref|NP_190745.6| Ethylene-overproduction protein 1 [Arabidopsis thaliana] gi|332645319|gb|AEE78840.1| Ethylene-overproduction protein 1 [Arabidopsis thaliana] Length = 951 Score = 62.4 bits (150), Expect = 2e-07 Identities = 31/50 (62%), Positives = 38/50 (76%) Frame = +2 Query: 629 LLPFGLPRTALLEPPIEPYLKSVNLVESLANVYKRLESCSSEEKSMVFLE 778 LLP GLP T LLEP I+P LK V+LVE +A VY+R+E+CS EKS +LE Sbjct: 89 LLPCGLPVTDLLEPQIDPCLKFVDLVEKMAQVYRRIENCSQFEKSGAYLE 138