BLASTX nr result
ID: Papaver25_contig00031637
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00031637 (441 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|C3SBU5.1|TNMT1_PAPBR RecName: Full=(S)-tetrahydroprotoberberi... 62 6e-08 sp|Q108P1.1|TNMT_PAPSO RecName: Full=(S)-tetrahydroprotoberberin... 62 6e-08 sp|C3SBU4.1|TNMT2_PAPBR RecName: Full=Probable (S)-tetrahydropro... 56 6e-06 >sp|C3SBU5.1|TNMT1_PAPBR RecName: Full=(S)-tetrahydroprotoberberine N-methyltransferase 1; Short=PbTNMT1 gi|226897732|gb|ACO90237.1| tetrahydroprotoberberine N-methyltransferase [Papaver bracteatum] Length = 358 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 437 LKGEIKDEELQKLLKFQFEKFLQWGYQSSHQE 342 LKGEIKDEEL+KL+KFQFEK LQWGY+SSHQE Sbjct: 20 LKGEIKDEELKKLIKFQFEKRLQWGYKSSHQE 51 >sp|Q108P1.1|TNMT_PAPSO RecName: Full=(S)-tetrahydroprotoberberine N-methyltransferase; Short=PsTNMT gi|67764091|gb|AAY79177.1| S-adenosyl-L-methionine:(S)-tetrahydroprotoberberine- cis-N-methyltransferase [Papaver somniferum] Length = 358 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 437 LKGEIKDEELQKLLKFQFEKFLQWGYQSSHQE 342 LKGEIKDEEL+KL+KFQFEK LQWGY+SSHQE Sbjct: 20 LKGEIKDEELKKLIKFQFEKRLQWGYKSSHQE 51 >sp|C3SBU4.1|TNMT2_PAPBR RecName: Full=Probable (S)-tetrahydroprotoberberine N-methyltransferase 2; Short=PbTNMT2 gi|226897730|gb|ACO90236.1| putative N-methyltransferase [Papaver bracteatum] Length = 358 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -2 Query: 437 LKGEIKDEELQKLLKFQFEKFLQWGYQSSHQE 342 L+GEI DEEL+KL+K+Q EK LQWGY+SSHQE Sbjct: 20 LRGEINDEELKKLIKYQLEKRLQWGYKSSHQE 51