BLASTX nr result
ID: Papaver25_contig00031134
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00031134 (507 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB86768.1| hypothetical protein L484_007792 [Morus notabilis] 56 6e-06 >gb|EXB86768.1| hypothetical protein L484_007792 [Morus notabilis] Length = 370 Score = 55.8 bits (133), Expect = 6e-06 Identities = 33/80 (41%), Positives = 45/80 (56%), Gaps = 4/80 (5%) Frame = +2 Query: 65 PSSLLPRPSCTKPKQETLRGKFGRTEVGKRLAVAANIIRVSTGTKTSVSSACLSTVDK-- 238 PS+LLP T P Q T +GK +VGKRL VA + + +S+ S + C S K Sbjct: 291 PSNLLPCRLPTSPSQGTSKGKIDGADVGKRLIVALDNLGISSSKTISPARLCRSRYGKGL 350 Query: 239 --FPKSLIRKIVFEVSDNDD 292 SL++K VFE+SD+DD Sbjct: 351 HLNSSSLVKKAVFEISDSDD 370