BLASTX nr result
ID: Papaver25_contig00030746
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00030746 (509 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_001867702.1| 30S ribosomal protein S19 [Nostoc punctiform... 92 7e-17 ref|YP_377960.1| 30S ribosomal protein S19 [Synechococcus sp. CC... 91 2e-16 ref|WP_009344504.1| 30S ribosomal protein S19 [Raphidiopsis broo... 91 2e-16 ref|WP_017314764.1| 30S ribosomal protein S19 [Mastigocladopsis ... 89 5e-16 ref|YP_004841824.1| ribosomal protein S19 [Cucumis melo subsp. m... 89 5e-16 ref|WP_006276958.1| 30S ribosomal protein S19 [Cylindrospermopsi... 89 5e-16 ref|YP_007082245.1| 30S ribosomal protein S19 [Pleurocapsa sp. P... 89 6e-16 ref|YP_380703.1| 30S ribosomal protein S19 [Synechococcus sp. CC... 89 6e-16 ref|YP_292318.1| 30S ribosomal protein S19 [Prochlorococcus mari... 89 6e-16 ref|YP_247640.1| ribosomal protein S19 [Cucumis sativus] gi|5900... 89 6e-16 ref|YP_001551559.1| 30S ribosomal protein S19 [Prochlorococcus m... 89 8e-16 ref|YP_321214.1| 30S ribosomal protein S19 [Anabaena variabilis ... 89 8e-16 ref|NP_488251.1| 30S ribosomal protein S19 [Nostoc sp. PCC 7120]... 89 8e-16 ref|YP_003890222.1| 30S ribosomal protein S19 [Cyanothece sp. PC... 89 8e-16 ref|NP_898162.1| 30S ribosomal protein S19 [Synechococcus sp. WH... 88 1e-15 emb|CDI27992.1| chloroplast 30S ribosomal protein S19 (chloropla... 88 1e-15 ref|WP_019508892.1| 30S ribosomal protein S19 [Pleurocapsa sp. P... 88 1e-15 ref|WP_017310490.1| 30S ribosomal protein S19 [Fischerella sp. P... 88 1e-15 ref|YP_001805432.1| 30S ribosomal protein S19 [Cyanothece sp. AT... 88 1e-15 ref|YP_001687252.1| ribosomal protein S19 [Aneura mirabilis] gi|... 88 1e-15 >ref|YP_001867702.1| 30S ribosomal protein S19 [Nostoc punctiforme PCC 73102] gi|501379155|ref|WP_012410721.1| 30S ribosomal protein S19 [Nostoc punctiforme] gi|226735223|sp|B2ITQ1.1|RS19_NOSP7 RecName: Full=30S ribosomal protein S19 gi|186466958|gb|ACC82759.1| ribosomal protein S19 [Nostoc punctiforme PCC 73102] Length = 92 Score = 92.0 bits (227), Expect = 7e-17 Identities = 39/61 (63%), Positives = 51/61 (83%) Frame = -3 Query: 420 DDNNVRAVIVTWARATTIIPCMVGMTVAIHNGKDHIIRSINERMVGHKLGEFAPTRTFHG 241 +DNN + VI TW+RA+TI+P MVG T+A+HNG+ H+ +NE+MVGHKLGEFAPTRT+ G Sbjct: 23 NDNNRKEVIKTWSRASTILPLMVGHTIAVHNGRQHVPVFVNEQMVGHKLGEFAPTRTYRG 82 Query: 240 H 238 H Sbjct: 83 H 83 >ref|YP_377960.1| 30S ribosomal protein S19 [Synechococcus sp. CC9902] gi|497474732|ref|WP_009788930.1| 30S ribosomal protein S19 [Synechococcus] gi|119367188|sp|Q3AUW8.1|RS19_SYNS9 RecName: Full=30S ribosomal protein S19 gi|78169820|gb|ABB26917.1| SSU ribosomal protein S19P [Synechococcus sp. CC9902] gi|116064447|gb|EAU70207.1| Ribosomal protein S19 [Synechococcus sp. BL107] Length = 91 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/61 (65%), Positives = 51/61 (83%) Frame = -3 Query: 420 DDNNVRAVIVTWARATTIIPCMVGMTVAIHNGKDHIIRSINERMVGHKLGEFAPTRTFHG 241 +DN+ ++VI TW+RA+TI+P M+G T+A+HNGK HI I E+MVGHKLGEFAPTRTF G Sbjct: 23 NDNDDKSVIKTWSRASTILPMMIGHTIAVHNGKSHIPVFITEQMVGHKLGEFAPTRTFKG 82 Query: 240 H 238 H Sbjct: 83 H 83 >ref|WP_009344504.1| 30S ribosomal protein S19 [Raphidiopsis brookii] gi|281196884|gb|EFA71789.1| Ribosomal protein S19 [Raphidiopsis brookii D9] Length = 92 Score = 90.9 bits (224), Expect = 2e-16 Identities = 39/59 (66%), Positives = 49/59 (83%) Frame = -3 Query: 414 NNVRAVIVTWARATTIIPCMVGMTVAIHNGKDHIIRSINERMVGHKLGEFAPTRTFHGH 238 NN + VI TW+RA+TI+P MVG T+A+HNGK H+ +NE+MVGHKLGEFAPTRT+ GH Sbjct: 25 NNEKQVIKTWSRASTILPLMVGHTIAVHNGKQHVPVFVNEQMVGHKLGEFAPTRTYRGH 83 >ref|WP_017314764.1| 30S ribosomal protein S19 [Mastigocladopsis repens] Length = 92 Score = 89.4 bits (220), Expect = 5e-16 Identities = 38/62 (61%), Positives = 52/62 (83%) Frame = -3 Query: 420 DDNNVRAVIVTWARATTIIPCMVGMTVAIHNGKDHIIRSINERMVGHKLGEFAPTRTFHG 241 ++NN + VI TW+RA+TI+P MVG T+A+HNG+ H+ I+++MVGHKLGEFAPTRTF G Sbjct: 23 NENNRKEVIKTWSRASTILPVMVGHTIAVHNGRQHVPIFISDQMVGHKLGEFAPTRTFRG 82 Query: 240 HT 235 H+ Sbjct: 83 HS 84 >ref|YP_004841824.1| ribosomal protein S19 [Cucumis melo subsp. melo] gi|344030532|gb|AEM76933.1| ribosomal protein S19 [Cucumis melo subsp. melo] Length = 92 Score = 89.4 bits (220), Expect = 5e-16 Identities = 39/56 (69%), Positives = 47/56 (83%) Frame = -3 Query: 405 RAVIVTWARATTIIPCMVGMTVAIHNGKDHIIRSINERMVGHKLGEFAPTRTFHGH 238 + +IVTW+RA+TIIP M+G T+AIHNGKDH+ I +RMVGHKLGEFAPTR F GH Sbjct: 28 KEIIVTWSRASTIIPTMIGHTIAIHNGKDHLPVYITDRMVGHKLGEFAPTRNFRGH 83 >ref|WP_006276958.1| 30S ribosomal protein S19 [Cylindrospermopsis raciborskii] gi|281195226|gb|EFA70162.1| Ribosomal protein S19 [Cylindrospermopsis raciborskii CS-505] Length = 92 Score = 89.4 bits (220), Expect = 5e-16 Identities = 38/59 (64%), Positives = 49/59 (83%) Frame = -3 Query: 414 NNVRAVIVTWARATTIIPCMVGMTVAIHNGKDHIIRSINERMVGHKLGEFAPTRTFHGH 238 NN + VI TW+RA+TI+P MVG T+A+HNGK H+ +NE+MVGHKLGEFAPTR++ GH Sbjct: 25 NNEKQVIKTWSRASTILPLMVGHTIAVHNGKQHVPVFVNEQMVGHKLGEFAPTRSYRGH 83 >ref|YP_007082245.1| 30S ribosomal protein S19 [Pleurocapsa sp. PCC 7327] gi|504957885|ref|WP_015144987.1| 30S ribosomal protein S19 [Pleurocapsa minor] gi|427981088|gb|AFY78688.1| ribosomal protein S19, bacterial/organelle [Pleurocapsa sp. PCC 7327] Length = 93 Score = 89.0 bits (219), Expect = 6e-16 Identities = 40/61 (65%), Positives = 49/61 (80%) Frame = -3 Query: 420 DDNNVRAVIVTWARATTIIPCMVGMTVAIHNGKDHIIRSINERMVGHKLGEFAPTRTFHG 241 +D N + VI TW+RA+TI+P MVG T+A+HNGK H+ I E+MVGHKLGEFAPTRTF G Sbjct: 23 NDRNEKQVIKTWSRASTIMPEMVGHTIAVHNGKQHVPIYITEQMVGHKLGEFAPTRTFRG 82 Query: 240 H 238 H Sbjct: 83 H 83 >ref|YP_380703.1| 30S ribosomal protein S19 [Synechococcus sp. CC9605] gi|493903941|ref|WP_006849645.1| 30S ribosomal protein S19 [Synechococcus sp. CC9605] gi|119367189|sp|Q3AMN4.1|RS19_SYNSC RecName: Full=30S ribosomal protein S19 gi|78196383|gb|ABB34148.1| ribosomal protein S19 [Synechococcus sp. CC9605] gi|572996522|gb|AHF62783.1| SSU ribosomal protein S19P [Synechococcus sp. WH 8109] Length = 91 Score = 89.0 bits (219), Expect = 6e-16 Identities = 38/61 (62%), Positives = 51/61 (83%) Frame = -3 Query: 420 DDNNVRAVIVTWARATTIIPCMVGMTVAIHNGKDHIIRSINERMVGHKLGEFAPTRTFHG 241 +DN+ ++VI TW+RA+TI+P M+G T+A+HNG+ H+ I E+MVGHKLGEFAPTRTF G Sbjct: 23 NDNDDKSVIKTWSRASTILPMMIGHTIAVHNGRTHVPVFITEQMVGHKLGEFAPTRTFKG 82 Query: 240 H 238 H Sbjct: 83 H 83 >ref|YP_292318.1| 30S ribosomal protein S19 [Prochlorococcus marinus str. NATL2A] gi|124026704|ref|YP_001015819.1| 30S ribosomal protein S19 [Prochlorococcus marinus str. NATL1A] gi|499614735|ref|WP_011295469.1| 30S ribosomal protein S19 [Prochlorococcus marinus] gi|119367140|sp|Q46IR3.1|RS19_PROMT RecName: Full=30S ribosomal protein S19 gi|166199901|sp|A2C4Z5.1|RS19_PROM1 RecName: Full=30S ribosomal protein S19 gi|72002813|gb|AAZ58615.1| SSU ribosomal protein S19P [Prochlorococcus marinus str. NATL2A] gi|123961772|gb|ABM76555.1| 30S Ribosomal protein S19 [Prochlorococcus marinus str. NATL1A] Length = 91 Score = 89.0 bits (219), Expect = 6e-16 Identities = 39/61 (63%), Positives = 50/61 (81%) Frame = -3 Query: 420 DDNNVRAVIVTWARATTIIPCMVGMTVAIHNGKDHIIRSINERMVGHKLGEFAPTRTFHG 241 + N+ +AVI TW+RA+TI+P M+G T+A+HNGK HI I E+MVGHKLGEFAPTRT+ G Sbjct: 23 NSNDDKAVIKTWSRASTILPLMIGHTIAVHNGKSHIPVFITEQMVGHKLGEFAPTRTYRG 82 Query: 240 H 238 H Sbjct: 83 H 83 >ref|YP_247640.1| ribosomal protein S19 [Cucumis sativus] gi|590000454|ref|YP_009004083.1| ribosomal protein S19 [Cucumis hystrix] gi|75317313|sp|Q4VZM8.1|RR19_CUCSA RecName: Full=30S ribosomal protein S19, chloroplastic gi|67511439|emb|CAJ00799.1| ribosomal protein S19 [Cucumis sativus] gi|74027140|gb|AAZ94690.1| ribosomal protein S19 [Cucumis sativus] gi|115432844|gb|ABI97457.1| ribosomal protein S19 [Cucumis sativus] gi|115498344|gb|ABI98786.1| ribosomal protein S19 [Cucumis sativus] gi|586598725|gb|AHJ61425.1| ribosomal protein S19 [Cucumis hystrix] Length = 92 Score = 89.0 bits (219), Expect = 6e-16 Identities = 38/56 (67%), Positives = 47/56 (83%) Frame = -3 Query: 405 RAVIVTWARATTIIPCMVGMTVAIHNGKDHIIRSINERMVGHKLGEFAPTRTFHGH 238 + +IVTW+RA+TIIP M+G T+A+HNGKDH+ I +RMVGHKLGEFAPTR F GH Sbjct: 28 KEIIVTWSRASTIIPTMIGHTIAVHNGKDHLPVYITDRMVGHKLGEFAPTRNFRGH 83 >ref|YP_001551559.1| 30S ribosomal protein S19 [Prochlorococcus marinus str. MIT 9211] gi|501151361|ref|WP_012196225.1| 30S ribosomal protein S19 [Prochlorococcus marinus] gi|226735232|sp|A9BCP3.1|RS19_PROM4 RecName: Full=30S ribosomal protein S19 gi|159889391|gb|ABX09605.1| 30S Ribosomal protein S19 [Prochlorococcus marinus str. MIT 9211] Length = 91 Score = 88.6 bits (218), Expect = 8e-16 Identities = 39/61 (63%), Positives = 50/61 (81%) Frame = -3 Query: 420 DDNNVRAVIVTWARATTIIPCMVGMTVAIHNGKDHIIRSINERMVGHKLGEFAPTRTFHG 241 + N+ R+VI TW+RA+TI+P M+G T+A+HNGK HI I E+MVGHKLGEFAPTRT+ G Sbjct: 23 NSNDDRSVIKTWSRASTILPVMIGHTIAVHNGKSHIPVFITEQMVGHKLGEFAPTRTYKG 82 Query: 240 H 238 H Sbjct: 83 H 83 >ref|YP_321214.1| 30S ribosomal protein S19 [Anabaena variabilis ATCC 29413] gi|499636831|ref|WP_011317565.1| 30S ribosomal protein S19 [Anabaena variabilis] gi|119367066|sp|Q3MFB7.1|RS19_ANAVT RecName: Full=30S ribosomal protein S19 gi|75700643|gb|ABA20319.1| SSU ribosomal protein S19P [Anabaena variabilis ATCC 29413] Length = 92 Score = 88.6 bits (218), Expect = 8e-16 Identities = 38/61 (62%), Positives = 50/61 (81%) Frame = -3 Query: 420 DDNNVRAVIVTWARATTIIPCMVGMTVAIHNGKDHIIRSINERMVGHKLGEFAPTRTFHG 241 +D N + VI TW+RA+TI+P MVG T+A+HNG+ H+ I+E+MVGHKLGEFAPTRT+ G Sbjct: 23 NDKNEKQVIKTWSRASTILPLMVGHTIAVHNGRQHVPVFISEQMVGHKLGEFAPTRTYRG 82 Query: 240 H 238 H Sbjct: 83 H 83 >ref|NP_488251.1| 30S ribosomal protein S19 [Nostoc sp. PCC 7120] gi|499307574|ref|WP_010998349.1| 30S ribosomal protein S19 [Nostoc sp. PCC 7120] gi|20140063|sp|Q8YPI3.1|RS19_ANASP RecName: Full=30S ribosomal protein S19 gi|17133346|dbj|BAB75910.1| 30S ribosomal protein S19 [Nostoc sp. PCC 7120] Length = 92 Score = 88.6 bits (218), Expect = 8e-16 Identities = 38/61 (62%), Positives = 50/61 (81%) Frame = -3 Query: 420 DDNNVRAVIVTWARATTIIPCMVGMTVAIHNGKDHIIRSINERMVGHKLGEFAPTRTFHG 241 +D N + VI TW+RA+TI+P MVG T+A+HNG+ H+ I+E+MVGHKLGEFAPTRT+ G Sbjct: 23 NDRNEKQVIKTWSRASTILPLMVGHTIAVHNGRQHVPVFISEQMVGHKLGEFAPTRTYRG 82 Query: 240 H 238 H Sbjct: 83 H 83 >ref|YP_003890222.1| 30S ribosomal protein S19 [Cyanothece sp. PCC 7822] gi|503090143|ref|WP_013324985.1| 30S ribosomal protein S19 [Cyanothece sp. PCC 7822] gi|306985066|gb|ADN16947.1| ribosomal protein S19 [Cyanothece sp. PCC 7822] Length = 92 Score = 88.6 bits (218), Expect = 8e-16 Identities = 40/61 (65%), Positives = 49/61 (80%) Frame = -3 Query: 420 DDNNVRAVIVTWARATTIIPCMVGMTVAIHNGKDHIIRSINERMVGHKLGEFAPTRTFHG 241 +D + VI TW+RA+TIIP MVG T+A+HNGK H+ I+E+MVGHKLGEFAPTRTF G Sbjct: 23 NDKGEKQVIKTWSRASTIIPDMVGHTIAVHNGKQHVPIYISEQMVGHKLGEFAPTRTFRG 82 Query: 240 H 238 H Sbjct: 83 H 83 >ref|NP_898162.1| 30S ribosomal protein S19 [Synechococcus sp. WH 8102] gi|499441465|ref|WP_011128929.1| 30S ribosomal protein S19 [Synechococcus sp. WH 8102] gi|54036402|sp|Q7U4J6.1|RS19_SYNPX RecName: Full=30S ribosomal protein S19 gi|33633381|emb|CAE08586.1| 30S ribosomal protein S19 [Synechococcus sp. WH 8102] Length = 91 Score = 88.2 bits (217), Expect = 1e-15 Identities = 38/61 (62%), Positives = 50/61 (81%) Frame = -3 Query: 420 DDNNVRAVIVTWARATTIIPCMVGMTVAIHNGKDHIIRSINERMVGHKLGEFAPTRTFHG 241 +D + ++VI TW+RA+TI+P M+G T+A+HNGK H+ I E+MVGHKLGEFAPTRTF G Sbjct: 23 NDTDDKSVIKTWSRASTILPMMIGHTIAVHNGKSHVPVFITEQMVGHKLGEFAPTRTFKG 82 Query: 240 H 238 H Sbjct: 83 H 83 >emb|CDI27992.1| chloroplast 30S ribosomal protein S19 (chloroplast) [Acetabularia acetabulum] Length = 92 Score = 87.8 bits (216), Expect = 1e-15 Identities = 37/61 (60%), Positives = 50/61 (81%) Frame = -3 Query: 420 DDNNVRAVIVTWARATTIIPCMVGMTVAIHNGKDHIIRSINERMVGHKLGEFAPTRTFHG 241 ++ N + VI TW+R++TI+P M+G T+AIHNGK+HI I ++MVGHKLGEFAPTRT+ G Sbjct: 23 NEQNEKKVITTWSRSSTIVPIMIGHTIAIHNGKEHIPIFITDQMVGHKLGEFAPTRTYRG 82 Query: 240 H 238 H Sbjct: 83 H 83 >ref|WP_019508892.1| 30S ribosomal protein S19 [Pleurocapsa sp. PCC 7319] Length = 92 Score = 87.8 bits (216), Expect = 1e-15 Identities = 39/59 (66%), Positives = 49/59 (83%) Frame = -3 Query: 414 NNVRAVIVTWARATTIIPCMVGMTVAIHNGKDHIIRSINERMVGHKLGEFAPTRTFHGH 238 NN + VI TW+RA+TI+P MVG T+A+HNG+ HI I+++MVGHKLGEFAPTRTF GH Sbjct: 25 NNKKEVIKTWSRASTILPQMVGHTIAVHNGRQHIPVFISDQMVGHKLGEFAPTRTFRGH 83 >ref|WP_017310490.1| 30S ribosomal protein S19 [Fischerella sp. PCC 9339] Length = 91 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/62 (61%), Positives = 52/62 (83%) Frame = -3 Query: 420 DDNNVRAVIVTWARATTIIPCMVGMTVAIHNGKDHIIRSINERMVGHKLGEFAPTRTFHG 241 +D+N + VI TW+RA+TI+P MVG T+A+HNG+ H+ I+++MVGHKLGEFAPTRTF G Sbjct: 23 NDSNRKEVIKTWSRASTILPEMVGHTIAVHNGRQHVPVFISDQMVGHKLGEFAPTRTFRG 82 Query: 240 HT 235 H+ Sbjct: 83 HS 84 >ref|YP_001805432.1| 30S ribosomal protein S19 [Cyanothece sp. ATCC 51142] gi|497229630|ref|WP_009543892.1| 30S ribosomal protein S19 [Cyanothece sp. ATCC 51142] gi|254812994|sp|B1WQR4.1|RS19_CYAA5 RecName: Full=30S ribosomal protein S19 gi|171700385|gb|ACB53366.1| 30S ribosomal protein S19 [Cyanothece sp. ATCC 51142] Length = 92 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/57 (66%), Positives = 48/57 (84%) Frame = -3 Query: 405 RAVIVTWARATTIIPCMVGMTVAIHNGKDHIIRSINERMVGHKLGEFAPTRTFHGHT 235 + VI TW+RA+TIIP M+G T+A+HNGK H+ I+E+MVGHKLGEFAPTRTF GH+ Sbjct: 28 KQVIKTWSRASTIIPAMIGHTIAVHNGKQHVPIFISEQMVGHKLGEFAPTRTFRGHS 84 >ref|YP_001687252.1| ribosomal protein S19 [Aneura mirabilis] gi|215275029|sp|B0YPR6.1|RR19_ANEMR RecName: Full=30S ribosomal protein S19, plastid gi|153973854|gb|ABS54514.1| ribosomal protein S19 [Aneura mirabilis] Length = 92 Score = 87.8 bits (216), Expect = 1e-15 Identities = 37/54 (68%), Positives = 47/54 (87%) Frame = -3 Query: 399 VIVTWARATTIIPCMVGMTVAIHNGKDHIIRSINERMVGHKLGEFAPTRTFHGH 238 V+VTW+RA+TI+P M+G T+AIHNG++H+ I +RMVGHKLGEFAPTRTF GH Sbjct: 30 VVVTWSRASTIVPVMIGHTIAIHNGREHLPIYITDRMVGHKLGEFAPTRTFRGH 83