BLASTX nr result
ID: Papaver25_contig00030603
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00030603 (1230 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_740245.1| hypothetical chloroplast RF2 [Liriodendron tuli... 90 7e-21 gb|ADD30889.1| putative RF2 protein [Ximenia americana] gi|34080... 89 1e-20 gb|AEK78171.1| hypothetical chloroplast RF2 [Saruma henryi] 89 2e-20 gb|AEK78147.1| hypothetical chloroplast RF2 [Canella winterana] 87 6e-20 ref|YP_008993735.1| hypothetical chloroplast RF21 (chloroplast) ... 87 6e-20 ref|YP_008993907.1| hypothetical chloroplast RF21 (chloroplast) ... 87 6e-20 ref|YP_008993821.1| hypothetical chloroplast RF21 (chloroplast) ... 87 6e-20 ref|YP_008993649.1| hypothetical chloroplast RF21 (chloroplast) ... 87 6e-20 ref|YP_008993391.1| hypothetical chloroplast RF21 (chloroplast) ... 87 6e-20 ref|YP_008993219.1| hypothetical chloroplast RF21 (chloroplast) ... 87 6e-20 gb|AEX99130.1| hypothetical chloroplast RF2 (chloroplast) [Magno... 87 6e-20 ref|YP_007474579.1| hypothetical chloroplast RF2 (chloroplast) [... 87 6e-20 gb|AEX98795.1| hypothetical chloroplast RF2-like protein (chloro... 87 6e-20 gb|AEX98728.1| hypothetical chloroplast RF2 (chloroplast) [Magno... 87 6e-20 gb|AEX98711.1| hypothetical chloroplast RF2 (chloroplast) [Magno... 87 6e-20 ref|YP_007474495.1| hypothetical chloroplast RF2 (chloroplast) [... 87 6e-20 ref|YP_007474412.1| hypothetical chloroplast RF2 (chloroplast) [... 87 6e-20 ref|YP_006576157.1| Ycf2 (chloroplast) [Magnolia denudata] gi|40... 87 6e-20 ref|YP_004769757.1| hypothetical chloroplast RF21 [Magnolia kwan... 87 6e-20 ref|YP_740609.1| hypothetical chloroplast RF2 [Platanus occident... 87 6e-20 >ref|YP_740245.1| hypothetical chloroplast RF2 [Liriodendron tulipifera] gi|114107109|ref|YP_740264.1| hypothetical chloroplast RF2 [Liriodendron tulipifera] gi|122246286|sp|Q0G9F7.1|YCF2_LIRTU RecName: Full=Protein Ycf2 gi|113201037|gb|ABI32552.1| hypothetical chloroplast RF2 [Liriodendron tulipifera] gi|113201057|gb|ABI32572.1| hypothetical chloroplast RF2 [Liriodendron tulipifera] Length = 2292 Score = 90.1 bits (222), Expect(2) = 7e-21 Identities = 43/54 (79%), Positives = 45/54 (83%), Gaps = 4/54 (7%) Frame = -1 Query: 1176 RDFYMKNESEFEGG----ALDPQQIEEYLFNHIVWAPRIWRPCGSLFDCIERSN 1027 R Y K ESEFEGG ALDPQQIEE LFNHIVWAPRIWRPCG+LFDCIER+N Sbjct: 2048 RFLYEKYESEFEGGEGEGALDPQQIEEDLFNHIVWAPRIWRPCGNLFDCIERTN 2101 Score = 38.5 bits (88), Expect(2) = 7e-21 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 1210 LMQNGSCSFVDQRFLYEK 1157 +MQNGSCS VDQRFLYEK Sbjct: 2036 MMQNGSCSIVDQRFLYEK 2053 >gb|ADD30889.1| putative RF2 protein [Ximenia americana] gi|340807071|gb|AEK71677.1| hypothetical chloroplast RF2 [Ximenia americana] Length = 2285 Score = 89.4 bits (220), Expect(2) = 1e-20 Identities = 42/51 (82%), Positives = 43/51 (84%) Frame = -1 Query: 1176 RDFYMKNESEFEGGALDPQQIEEYLFNHIVWAPRIWRPCGSLFDCIERSNS 1024 R Y K+ESEFE GALDPQQIEE LFNHIVWAPRIWRP G LFDCIER NS Sbjct: 2042 RFLYEKDESEFEEGALDPQQIEEDLFNHIVWAPRIWRPWGFLFDCIERPNS 2092 Score = 38.5 bits (88), Expect(2) = 1e-20 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 1210 LMQNGSCSFVDQRFLYEK 1157 +MQNGSCS VDQRFLYEK Sbjct: 2030 MMQNGSCSIVDQRFLYEK 2047 >gb|AEK78171.1| hypothetical chloroplast RF2 [Saruma henryi] Length = 2307 Score = 88.6 bits (218), Expect(2) = 2e-20 Identities = 43/53 (81%), Positives = 44/53 (83%), Gaps = 2/53 (3%) Frame = -1 Query: 1176 RDFYMKNESEFEGG--ALDPQQIEEYLFNHIVWAPRIWRPCGSLFDCIERSNS 1024 R Y K ESEFE G ALDPQQIEE LFNHIVWAPRIWRPCG+LFDCIER NS Sbjct: 2061 RFLYEKYESEFEEGEGALDPQQIEEDLFNHIVWAPRIWRPCGNLFDCIERPNS 2113 Score = 38.5 bits (88), Expect(2) = 2e-20 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 1210 LMQNGSCSFVDQRFLYEK 1157 +MQNGSCS VDQRFLYEK Sbjct: 2049 MMQNGSCSIVDQRFLYEK 2066 >gb|AEK78147.1| hypothetical chloroplast RF2 [Canella winterana] Length = 2311 Score = 87.0 bits (214), Expect(2) = 6e-20 Identities = 42/52 (80%), Positives = 43/52 (82%), Gaps = 2/52 (3%) Frame = -1 Query: 1176 RDFYMKNESEFEGG--ALDPQQIEEYLFNHIVWAPRIWRPCGSLFDCIERSN 1027 R Y K ESEFE G ALDPQQIEE LFNHIVWAPRIWRPCG+LFDCIER N Sbjct: 2066 RFLYEKYESEFEEGEGALDPQQIEEDLFNHIVWAPRIWRPCGNLFDCIERPN 2117 Score = 38.5 bits (88), Expect(2) = 6e-20 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 1210 LMQNGSCSFVDQRFLYEK 1157 +MQNGSCS VDQRFLYEK Sbjct: 2054 MMQNGSCSIVDQRFLYEK 2071 >ref|YP_008993735.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia salicifolia] gi|573972436|ref|YP_008993754.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia salicifolia] Length = 2298 Score = 87.0 bits (214), Expect(2) = 6e-20 Identities = 42/54 (77%), Positives = 44/54 (81%), Gaps = 4/54 (7%) Frame = -1 Query: 1176 RDFYMKNESEFEGG----ALDPQQIEEYLFNHIVWAPRIWRPCGSLFDCIERSN 1027 R Y K ESEFE G ALDPQQIEE LFNHIVWAPRIWRPCG+LFDCIER+N Sbjct: 2051 RFLYEKYESEFEEGEGEGALDPQQIEEDLFNHIVWAPRIWRPCGNLFDCIERTN 2104 Score = 38.5 bits (88), Expect(2) = 6e-20 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 1210 LMQNGSCSFVDQRFLYEK 1157 +MQNGSCS VDQRFLYEK Sbjct: 2039 MMQNGSCSIVDQRFLYEK 2056 >ref|YP_008993907.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia sprengeri] gi|570772356|ref|YP_008993926.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia sprengeri] Length = 2298 Score = 87.0 bits (214), Expect(2) = 6e-20 Identities = 42/54 (77%), Positives = 44/54 (81%), Gaps = 4/54 (7%) Frame = -1 Query: 1176 RDFYMKNESEFEGG----ALDPQQIEEYLFNHIVWAPRIWRPCGSLFDCIERSN 1027 R Y K ESEFE G ALDPQQIEE LFNHIVWAPRIWRPCG+LFDCIER+N Sbjct: 2051 RFLYEKYESEFEEGEGEGALDPQQIEEDLFNHIVWAPRIWRPCGNLFDCIERTN 2104 Score = 38.5 bits (88), Expect(2) = 6e-20 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 1210 LMQNGSCSFVDQRFLYEK 1157 +MQNGSCS VDQRFLYEK Sbjct: 2039 MMQNGSCSIVDQRFLYEK 2056 >ref|YP_008993821.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia sinica] gi|570772258|ref|YP_008993840.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia sinica] Length = 2298 Score = 87.0 bits (214), Expect(2) = 6e-20 Identities = 42/54 (77%), Positives = 44/54 (81%), Gaps = 4/54 (7%) Frame = -1 Query: 1176 RDFYMKNESEFEGG----ALDPQQIEEYLFNHIVWAPRIWRPCGSLFDCIERSN 1027 R Y K ESEFE G ALDPQQIEE LFNHIVWAPRIWRPCG+LFDCIER+N Sbjct: 2051 RFLYEKYESEFEEGEGEGALDPQQIEEDLFNHIVWAPRIWRPCGNLFDCIERTN 2104 Score = 38.5 bits (88), Expect(2) = 6e-20 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 1210 LMQNGSCSFVDQRFLYEK 1157 +MQNGSCS VDQRFLYEK Sbjct: 2039 MMQNGSCSIVDQRFLYEK 2056 >ref|YP_008993649.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia odora] gi|570760248|ref|YP_008993668.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia odora] Length = 2298 Score = 87.0 bits (214), Expect(2) = 6e-20 Identities = 42/54 (77%), Positives = 44/54 (81%), Gaps = 4/54 (7%) Frame = -1 Query: 1176 RDFYMKNESEFEGG----ALDPQQIEEYLFNHIVWAPRIWRPCGSLFDCIERSN 1027 R Y K ESEFE G ALDPQQIEE LFNHIVWAPRIWRPCG+LFDCIER+N Sbjct: 2051 RFLYEKYESEFEEGEGEGALDPQQIEEDLFNHIVWAPRIWRPCGNLFDCIERTN 2104 Score = 38.5 bits (88), Expect(2) = 6e-20 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 1210 LMQNGSCSFVDQRFLYEK 1157 +MQNGSCS VDQRFLYEK Sbjct: 2039 MMQNGSCSIVDQRFLYEK 2056 >ref|YP_008993391.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia pyramidata] gi|570759987|ref|YP_008993410.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia pyramidata] Length = 2298 Score = 87.0 bits (214), Expect(2) = 6e-20 Identities = 42/54 (77%), Positives = 44/54 (81%), Gaps = 4/54 (7%) Frame = -1 Query: 1176 RDFYMKNESEFEGG----ALDPQQIEEYLFNHIVWAPRIWRPCGSLFDCIERSN 1027 R Y K ESEFE G ALDPQQIEE LFNHIVWAPRIWRPCG+LFDCIER+N Sbjct: 2051 RFLYEKYESEFEEGEGEGALDPQQIEEDLFNHIVWAPRIWRPCGNLFDCIERTN 2104 Score = 38.5 bits (88), Expect(2) = 6e-20 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 1210 LMQNGSCSFVDQRFLYEK 1157 +MQNGSCS VDQRFLYEK Sbjct: 2039 MMQNGSCSIVDQRFLYEK 2056 >ref|YP_008993219.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia cathcartii] gi|570759813|ref|YP_008993238.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia cathcartii] Length = 2298 Score = 87.0 bits (214), Expect(2) = 6e-20 Identities = 42/54 (77%), Positives = 44/54 (81%), Gaps = 4/54 (7%) Frame = -1 Query: 1176 RDFYMKNESEFEGG----ALDPQQIEEYLFNHIVWAPRIWRPCGSLFDCIERSN 1027 R Y K ESEFE G ALDPQQIEE LFNHIVWAPRIWRPCG+LFDCIER+N Sbjct: 2051 RFLYEKYESEFEEGEGEGALDPQQIEEDLFNHIVWAPRIWRPCGNLFDCIERTN 2104 Score = 38.5 bits (88), Expect(2) = 6e-20 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 1210 LMQNGSCSFVDQRFLYEK 1157 +MQNGSCS VDQRFLYEK Sbjct: 2039 MMQNGSCSIVDQRFLYEK 2056 >gb|AEX99130.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia grandiflora] Length = 2298 Score = 87.0 bits (214), Expect(2) = 6e-20 Identities = 42/54 (77%), Positives = 44/54 (81%), Gaps = 4/54 (7%) Frame = -1 Query: 1176 RDFYMKNESEFEGG----ALDPQQIEEYLFNHIVWAPRIWRPCGSLFDCIERSN 1027 R Y K ESEFE G ALDPQQIEE LFNHIVWAPRIWRPCG+LFDCIER+N Sbjct: 2051 RFLYEKYESEFEEGEGEGALDPQQIEEDLFNHIVWAPRIWRPCGNLFDCIERTN 2104 Score = 38.5 bits (88), Expect(2) = 6e-20 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 1210 LMQNGSCSFVDQRFLYEK 1157 +MQNGSCS VDQRFLYEK Sbjct: 2039 MMQNGSCSIVDQRFLYEK 2056 >ref|YP_007474579.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia grandiflora] gi|452848915|ref|YP_007474596.1| photosystem I assembly protein Ycf2 (chloroplast) [Magnolia grandiflora] gi|372862885|gb|AEX98961.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia grandiflora] gi|372862902|gb|AEX98978.1| photosystem I assembly protein Ycf2 (chloroplast) [Magnolia grandiflora] Length = 2298 Score = 87.0 bits (214), Expect(2) = 6e-20 Identities = 42/54 (77%), Positives = 44/54 (81%), Gaps = 4/54 (7%) Frame = -1 Query: 1176 RDFYMKNESEFEGG----ALDPQQIEEYLFNHIVWAPRIWRPCGSLFDCIERSN 1027 R Y K ESEFE G ALDPQQIEE LFNHIVWAPRIWRPCG+LFDCIER+N Sbjct: 2051 RFLYEKYESEFEEGEGEGALDPQQIEEDLFNHIVWAPRIWRPCGNLFDCIERTN 2104 Score = 38.5 bits (88), Expect(2) = 6e-20 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 1210 LMQNGSCSFVDQRFLYEK 1157 +MQNGSCS VDQRFLYEK Sbjct: 2039 MMQNGSCSIVDQRFLYEK 2056 >gb|AEX98795.1| hypothetical chloroplast RF2-like protein (chloroplast) [Magnolia officinalis subsp. biloba] gi|372862734|gb|AEX98812.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia officinalis subsp. biloba] Length = 2298 Score = 87.0 bits (214), Expect(2) = 6e-20 Identities = 42/54 (77%), Positives = 44/54 (81%), Gaps = 4/54 (7%) Frame = -1 Query: 1176 RDFYMKNESEFEGG----ALDPQQIEEYLFNHIVWAPRIWRPCGSLFDCIERSN 1027 R Y K ESEFE G ALDPQQIEE LFNHIVWAPRIWRPCG+LFDCIER+N Sbjct: 2051 RFLYEKYESEFEEGEGEGALDPQQIEEDLFNHIVWAPRIWRPCGNLFDCIERTN 2104 Score = 38.5 bits (88), Expect(2) = 6e-20 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 1210 LMQNGSCSFVDQRFLYEK 1157 +MQNGSCS VDQRFLYEK Sbjct: 2039 MMQNGSCSIVDQRFLYEK 2056 >gb|AEX98728.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia officinalis subsp. biloba] Length = 2298 Score = 87.0 bits (214), Expect(2) = 6e-20 Identities = 42/54 (77%), Positives = 44/54 (81%), Gaps = 4/54 (7%) Frame = -1 Query: 1176 RDFYMKNESEFEGG----ALDPQQIEEYLFNHIVWAPRIWRPCGSLFDCIERSN 1027 R Y K ESEFE G ALDPQQIEE LFNHIVWAPRIWRPCG+LFDCIER+N Sbjct: 2051 RFLYEKYESEFEEGEGEGALDPQQIEEDLFNHIVWAPRIWRPCGNLFDCIERTN 2104 Score = 38.5 bits (88), Expect(2) = 6e-20 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 1210 LMQNGSCSFVDQRFLYEK 1157 +MQNGSCS VDQRFLYEK Sbjct: 2039 MMQNGSCSIVDQRFLYEK 2056 >gb|AEX98711.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia officinalis subsp. biloba] Length = 2298 Score = 87.0 bits (214), Expect(2) = 6e-20 Identities = 42/54 (77%), Positives = 44/54 (81%), Gaps = 4/54 (7%) Frame = -1 Query: 1176 RDFYMKNESEFEGG----ALDPQQIEEYLFNHIVWAPRIWRPCGSLFDCIERSN 1027 R Y K ESEFE G ALDPQQIEE LFNHIVWAPRIWRPCG+LFDCIER+N Sbjct: 2051 RFLYEKYESEFEEGEGEGALDPQQIEEDLFNHIVWAPRIWRPCGNLFDCIERTN 2104 Score = 38.5 bits (88), Expect(2) = 6e-20 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 1210 LMQNGSCSFVDQRFLYEK 1157 +MQNGSCS VDQRFLYEK Sbjct: 2039 MMQNGSCSIVDQRFLYEK 2056 >ref|YP_007474495.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia officinalis subsp. biloba] gi|452848831|ref|YP_007474512.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia officinalis subsp. biloba] gi|372862547|gb|AEX98627.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia officinalis subsp. biloba] gi|372862564|gb|AEX98644.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia officinalis subsp. biloba] Length = 2298 Score = 87.0 bits (214), Expect(2) = 6e-20 Identities = 42/54 (77%), Positives = 44/54 (81%), Gaps = 4/54 (7%) Frame = -1 Query: 1176 RDFYMKNESEFEGG----ALDPQQIEEYLFNHIVWAPRIWRPCGSLFDCIERSN 1027 R Y K ESEFE G ALDPQQIEE LFNHIVWAPRIWRPCG+LFDCIER+N Sbjct: 2051 RFLYEKYESEFEEGEGEGALDPQQIEEDLFNHIVWAPRIWRPCGNLFDCIERTN 2104 Score = 38.5 bits (88), Expect(2) = 6e-20 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 1210 LMQNGSCSFVDQRFLYEK 1157 +MQNGSCS VDQRFLYEK Sbjct: 2039 MMQNGSCSIVDQRFLYEK 2056 >ref|YP_007474412.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia officinalis] gi|452848746|ref|YP_007474428.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia officinalis] gi|570759881|ref|YP_008993305.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia dealbata] gi|570759900|ref|YP_008993324.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia dealbata] gi|619275778|ref|YP_009026924.1| hypothetical protein RF2 [Magnolia tripetala] gi|619275797|ref|YP_009026943.1| hypothetical protein RF2 [Magnolia tripetala] gi|372862463|gb|AEX98544.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia officinalis] gi|372862479|gb|AEX98560.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia officinalis] gi|608608446|gb|AHW52000.1| hypothetical protein RF2 [Magnolia tripetala] gi|608608465|gb|AHW52019.1| hypothetical protein RF2 [Magnolia tripetala] Length = 2298 Score = 87.0 bits (214), Expect(2) = 6e-20 Identities = 42/54 (77%), Positives = 44/54 (81%), Gaps = 4/54 (7%) Frame = -1 Query: 1176 RDFYMKNESEFEGG----ALDPQQIEEYLFNHIVWAPRIWRPCGSLFDCIERSN 1027 R Y K ESEFE G ALDPQQIEE LFNHIVWAPRIWRPCG+LFDCIER+N Sbjct: 2051 RFLYEKYESEFEEGEGEGALDPQQIEEDLFNHIVWAPRIWRPCGNLFDCIERTN 2104 Score = 38.5 bits (88), Expect(2) = 6e-20 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 1210 LMQNGSCSFVDQRFLYEK 1157 +MQNGSCS VDQRFLYEK Sbjct: 2039 MMQNGSCSIVDQRFLYEK 2056 >ref|YP_006576157.1| Ycf2 (chloroplast) [Magnolia denudata] gi|400256649|ref|YP_006576176.1| Ycf2 (chloroplast) [Magnolia denudata] gi|570760055|ref|YP_008993477.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia kobus] gi|570760074|ref|YP_008993496.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia kobus] gi|570760142|ref|YP_008993563.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia liliifera] gi|570760161|ref|YP_008993582.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia liliifera] gi|343887581|gb|AEM65260.1| Ycf2 [Magnolia denudata] gi|343887600|gb|AEM65279.1| Ycf2 [Magnolia denudata] gi|372862210|gb|AEX98294.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia liliiflora] gi|372862226|gb|AEX98310.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia liliiflora] gi|372862294|gb|AEX98377.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia denudata] gi|372862311|gb|AEX98394.1| photosystem I assembly protein Ycf2 (chloroplast) [Magnolia denudata] Length = 2298 Score = 87.0 bits (214), Expect(2) = 6e-20 Identities = 42/54 (77%), Positives = 44/54 (81%), Gaps = 4/54 (7%) Frame = -1 Query: 1176 RDFYMKNESEFEGG----ALDPQQIEEYLFNHIVWAPRIWRPCGSLFDCIERSN 1027 R Y K ESEFE G ALDPQQIEE LFNHIVWAPRIWRPCG+LFDCIER+N Sbjct: 2051 RFLYEKYESEFEEGEGEGALDPQQIEEDLFNHIVWAPRIWRPCGNLFDCIERTN 2104 Score = 38.5 bits (88), Expect(2) = 6e-20 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 1210 LMQNGSCSFVDQRFLYEK 1157 +MQNGSCS VDQRFLYEK Sbjct: 2039 MMQNGSCSIVDQRFLYEK 2056 >ref|YP_004769757.1| hypothetical chloroplast RF21 [Magnolia kwangsiensis] gi|342316266|ref|YP_004769774.1| hypothetical chloroplast RF21 [Magnolia kwangsiensis] gi|302424223|gb|ADL39099.1| hypothetical chloroplast RF21 [Magnolia kwangsiensis] gi|302424241|gb|ADL39117.1| hypothetical chloroplast RF21 [Magnolia kwangsiensis] Length = 2298 Score = 87.0 bits (214), Expect(2) = 6e-20 Identities = 42/54 (77%), Positives = 44/54 (81%), Gaps = 4/54 (7%) Frame = -1 Query: 1176 RDFYMKNESEFEGG----ALDPQQIEEYLFNHIVWAPRIWRPCGSLFDCIERSN 1027 R Y K ESEFE G ALDPQQIEE LFNHIVWAPRIWRPCG+LFDCIER+N Sbjct: 2051 RFLYEKYESEFEEGEGEGALDPQQIEEDLFNHIVWAPRIWRPCGNLFDCIERTN 2104 Score = 38.5 bits (88), Expect(2) = 6e-20 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 1210 LMQNGSCSFVDQRFLYEK 1157 +MQNGSCS VDQRFLYEK Sbjct: 2039 MMQNGSCSIVDQRFLYEK 2056 >ref|YP_740609.1| hypothetical chloroplast RF2 [Platanus occidentalis] gi|114329808|ref|YP_740626.1| hypothetical chloroplast RF2 [Platanus occidentalis] gi|122165984|sp|Q09FY5.1|YCF2_PLAOC RecName: Full=Protein Ycf2 gi|114054429|gb|ABI49823.1| hypothetical chloroplast RF2 [Platanus occidentalis] gi|114054446|gb|ABI49840.1| hypothetical chloroplast RF2 [Platanus occidentalis] Length = 2293 Score = 87.0 bits (214), Expect(2) = 6e-20 Identities = 42/52 (80%), Positives = 43/52 (82%), Gaps = 2/52 (3%) Frame = -1 Query: 1176 RDFYMKNESEFEGG--ALDPQQIEEYLFNHIVWAPRIWRPCGSLFDCIERSN 1027 R Y K ESEFE G ALDPQQIEE LFNHIVWAPRIWRPCG+LFDCIER N Sbjct: 2048 RFLYEKYESEFEEGEGALDPQQIEEDLFNHIVWAPRIWRPCGNLFDCIERPN 2099 Score = 38.5 bits (88), Expect(2) = 6e-20 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 1210 LMQNGSCSFVDQRFLYEK 1157 +MQNGSCS VDQRFLYEK Sbjct: 2036 MMQNGSCSIVDQRFLYEK 2053