BLASTX nr result
ID: Papaver25_contig00030563
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00030563 (464 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281775.1| PREDICTED: uncharacterized protein LOC100242... 60 4e-07 emb|CAN78966.1| hypothetical protein VITISV_019939 [Vitis vinifera] 60 4e-07 ref|XP_002528818.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002281775.1| PREDICTED: uncharacterized protein LOC100242675 [Vitis vinifera] Length = 153 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = +1 Query: 10 ARPQQQHSNYADVANLLKCEGLHIEGIVNPTQLARWLHM 126 ARP +QH +Y ++A+LLK +G HI GIVNPTQLARW+ M Sbjct: 110 ARPAKQHQSYGELASLLKTDGAHIPGIVNPTQLARWIQM 148 >emb|CAN78966.1| hypothetical protein VITISV_019939 [Vitis vinifera] Length = 153 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = +1 Query: 10 ARPQQQHSNYADVANLLKCEGLHIEGIVNPTQLARWLHM 126 ARP +QH +Y ++A+LLK +G HI GIVNPTQLARW+ M Sbjct: 110 ARPAKQHQSYGELASLLKTDGAHIPGIVNPTQLARWIQM 148 >ref|XP_002528818.1| conserved hypothetical protein [Ricinus communis] gi|223531730|gb|EEF33552.1| conserved hypothetical protein [Ricinus communis] Length = 142 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/38 (60%), Positives = 31/38 (81%) Frame = +1 Query: 13 RPQQQHSNYADVANLLKCEGLHIEGIVNPTQLARWLHM 126 R +++H +YA+VA +LK EG H+ GIVNPTQLARW+ M Sbjct: 105 RWKKEHKSYAEVAGILKTEGAHLPGIVNPTQLARWIQM 142