BLASTX nr result
ID: Papaver25_contig00030086
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00030086 (518 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004963494.1| PREDICTED: E3 ubiquitin-protein ligase ORTHR... 55 1e-05 >ref|XP_004963494.1| PREDICTED: E3 ubiquitin-protein ligase ORTHRUS 2-like [Setaria italica] Length = 737 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/34 (79%), Positives = 28/34 (82%), Gaps = 1/34 (2%) Frame = +2 Query: 401 RLHKEKRSSYAPESEL*YDG-YKIEKCWRKFEIQ 499 R HKEKRSSYAPES L YDG Y+IEKCWRK IQ Sbjct: 361 RSHKEKRSSYAPESGLRYDGIYRIEKCWRKIGIQ 394