BLASTX nr result
ID: Papaver25_contig00029784
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00029784 (419 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004146229.1| PREDICTED: 50S ribosomal protein L9-like [Cu... 56 6e-06 >ref|XP_004146229.1| PREDICTED: 50S ribosomal protein L9-like [Cucumis sativus] gi|449517603|ref|XP_004165835.1| PREDICTED: 50S ribosomal protein L9-like [Cucumis sativus] Length = 218 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -1 Query: 197 SLEKLREAGETVKVSPGYFTNHLVSKMFVVPNIEK 93 S+EKL +AGETVKV+PGYF NHL+ K+ VPNIEK Sbjct: 49 SIEKLGKAGETVKVAPGYFRNHLMPKILAVPNIEK 83