BLASTX nr result
ID: Papaver25_contig00029303
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00029303 (460 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC31535.1| Bromodomain and PHD finger-containing protein 3 [... 58 1e-06 ref|XP_002520929.1| bromodomain-containing protein [Ricinus comm... 58 1e-06 ref|XP_006384849.1| hypothetical protein POPTR_0004s21620g [Popu... 58 2e-06 ref|XP_007043059.1| DNA-binding bromodomain-containing protein, ... 58 2e-06 ref|XP_002279830.1| PREDICTED: uncharacterized protein LOC100245... 57 3e-06 ref|XP_004290062.1| PREDICTED: uncharacterized protein LOC101300... 57 3e-06 ref|XP_007201207.1| hypothetical protein PRUPE_ppa001719mg [Prun... 57 3e-06 >gb|EXC31535.1| Bromodomain and PHD finger-containing protein 3 [Morus notabilis] Length = 762 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -1 Query: 460 SVPPDLNVRFQSPGSPSSGVRVDSPQPDLALQL 362 SVPPDLNVRFQSPGSPSS RVDS QPDLALQL Sbjct: 731 SVPPDLNVRFQSPGSPSSS-RVDSTQPDLALQL 762 >ref|XP_002520929.1| bromodomain-containing protein [Ricinus communis] gi|223539895|gb|EEF41474.1| bromodomain-containing protein [Ricinus communis] Length = 767 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -1 Query: 460 SVPPDLNVRFQSPGSPSSGVRVDSPQPDLALQL 362 SVPPDLNVRFQSPGSPSS RVDS QPDLALQL Sbjct: 736 SVPPDLNVRFQSPGSPSSN-RVDSAQPDLALQL 767 >ref|XP_006384849.1| hypothetical protein POPTR_0004s21620g [Populus trichocarpa] gi|550341617|gb|ERP62646.1| hypothetical protein POPTR_0004s21620g [Populus trichocarpa] Length = 763 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 460 SVPPDLNVRFQSPGSPSSGVRVDSPQPDLALQL 362 +VPPDLNVR+QSPGSPSSG R+DS QPDLALQL Sbjct: 732 AVPPDLNVRYQSPGSPSSG-RIDSAQPDLALQL 763 >ref|XP_007043059.1| DNA-binding bromodomain-containing protein, putative [Theobroma cacao] gi|508706994|gb|EOX98890.1| DNA-binding bromodomain-containing protein, putative [Theobroma cacao] Length = 839 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 460 SVPPDLNVRFQSPGSPSSGVRVDSPQPDLALQL 362 SVPPDLN+RFQSPGSPSS RVDS QPDLALQL Sbjct: 808 SVPPDLNIRFQSPGSPSSS-RVDSAQPDLALQL 839 >ref|XP_002279830.1| PREDICTED: uncharacterized protein LOC100245230 [Vitis vinifera] Length = 750 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 460 SVPPDLNVRFQSPGSPSSGVRVDSPQPDLALQL 362 SVPPDLNVRFQSPGSPSS +VDS QPDLALQL Sbjct: 719 SVPPDLNVRFQSPGSPSSS-KVDSTQPDLALQL 750 >ref|XP_004290062.1| PREDICTED: uncharacterized protein LOC101300581 [Fragaria vesca subsp. vesca] Length = 735 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -1 Query: 460 SVPPDLNVRFQSPGSPSSGVRVDSPQPDLALQL 362 SVPPDLNVRFQSPGSPSS R DS QPDLALQL Sbjct: 704 SVPPDLNVRFQSPGSPSSS-RADSTQPDLALQL 735 >ref|XP_007201207.1| hypothetical protein PRUPE_ppa001719mg [Prunus persica] gi|462396607|gb|EMJ02406.1| hypothetical protein PRUPE_ppa001719mg [Prunus persica] Length = 775 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -1 Query: 460 SVPPDLNVRFQSPGSPSSGVRVDSPQPDLALQL 362 SVPPDLNVRFQSPGSPSS R DS QPDLALQL Sbjct: 744 SVPPDLNVRFQSPGSPSSS-RTDSAQPDLALQL 775