BLASTX nr result
ID: Papaver25_contig00029169
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00029169 (514 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007027668.1| KCBP-interacting protein kinase, putative is... 57 3e-06 >ref|XP_007027668.1| KCBP-interacting protein kinase, putative isoform 1 [Theobroma cacao] gi|590631817|ref|XP_007027669.1| KCBP-interacting protein kinase, putative isoform 1 [Theobroma cacao] gi|508716273|gb|EOY08170.1| KCBP-interacting protein kinase, putative isoform 1 [Theobroma cacao] gi|508716274|gb|EOY08171.1| KCBP-interacting protein kinase, putative isoform 1 [Theobroma cacao] Length = 874 Score = 57.0 bits (136), Expect = 3e-06 Identities = 31/62 (50%), Positives = 38/62 (61%) Frame = +1 Query: 328 MDPYPGTCEIVEAMEEFDCIQRHRGTSPPSFELGMEGKVRKLPSAKAGQYYSMEDELNKL 507 M Y GTCEIVEA EE +QR RG P LG+ K RK P K G S+E+++N+L Sbjct: 1 MGSYSGTCEIVEAGEELKPVQRSRGAYRPHSGLGVGDKDRKPPVLKLGFKDSLENDINQL 60 Query: 508 FE 513 FE Sbjct: 61 FE 62