BLASTX nr result
ID: Papaver25_contig00028406
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00028406 (422 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006488032.1| PREDICTED: 4-coumarate--CoA ligase-like 7-li... 64 2e-08 ref|XP_006424490.1| hypothetical protein CICLE_v10028138mg [Citr... 64 2e-08 ref|XP_006843037.1| hypothetical protein AMTR_s00076p00189570 [A... 63 5e-08 gb|AHL44983.1| 4-coumarate:coenzyme A ligase 4 [Fraxinus mandshu... 62 8e-08 ref|XP_006488029.1| PREDICTED: 4-coumarate--CoA ligase-like 7-li... 61 1e-07 ref|XP_006424485.1| hypothetical protein CICLE_v100281391mg, par... 61 1e-07 ref|XP_007016849.1| AMP-dependent synthetase and ligase family p... 61 1e-07 ref|XP_007208457.1| hypothetical protein PRUPE_ppa003893mg [Prun... 61 1e-07 ref|XP_006373451.1| 4-coumarate--CoA ligase family protein [Popu... 60 2e-07 gb|AGO89327.1| Ca4CL10 [Salix arbutifolia] 60 2e-07 ref|XP_004291645.1| PREDICTED: 4-coumarate--CoA ligase-like 7-li... 60 2e-07 ref|XP_002266472.2| PREDICTED: 4-coumarate--CoA ligase-like 7-li... 60 2e-07 emb|CBI30139.3| unnamed protein product [Vitis vinifera] 60 2e-07 gb|AFD33347.1| acyl-activating enzyme 3 [Cannabis sativa] 60 3e-07 gb|AGW27195.1| 4-coumarate:coenzyme A ligase 5 [Salvia miltiorrh... 60 4e-07 ref|XP_002523698.1| AMP dependent CoA ligase, putative [Ricinus ... 60 4e-07 ref|XP_007150153.1| hypothetical protein PHAVU_005G131400g [Phas... 59 5e-07 gb|AGW47869.1| 4-coumarate:coenzyme A ligase 4 [Phaseolus vulgaris] 59 5e-07 ref|XP_004251107.1| PREDICTED: 4-coumarate--CoA ligase-like 7-li... 59 7e-07 ref|XP_004147290.1| PREDICTED: 4-coumarate--CoA ligase-like 7-li... 59 7e-07 >ref|XP_006488032.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like [Citrus sinensis] Length = 545 Score = 63.9 bits (154), Expect = 2e-08 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 3 FKRLRRVTFINSVPKSVSGKILRRELIAKVRSKM 104 FKRLRRVTFINSVPKS SGKILRRELIAKVR+KM Sbjct: 512 FKRLRRVTFINSVPKSASGKILRRELIAKVRAKM 545 >ref|XP_006424490.1| hypothetical protein CICLE_v10028138mg [Citrus clementina] gi|557526424|gb|ESR37730.1| hypothetical protein CICLE_v10028138mg [Citrus clementina] Length = 545 Score = 63.9 bits (154), Expect = 2e-08 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 3 FKRLRRVTFINSVPKSVSGKILRRELIAKVRSKM 104 FKRLRRVTFINSVPKS SGKILRRELIAKVR+KM Sbjct: 512 FKRLRRVTFINSVPKSASGKILRRELIAKVRAKM 545 >ref|XP_006843037.1| hypothetical protein AMTR_s00076p00189570 [Amborella trichopoda] gi|548845234|gb|ERN04712.1| hypothetical protein AMTR_s00076p00189570 [Amborella trichopoda] Length = 543 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +3 Query: 3 FKRLRRVTFINSVPKSVSGKILRRELIAKVRSKM 104 FKRLRRVTF+NSVPKS SGKILRRELI KVRSKM Sbjct: 510 FKRLRRVTFVNSVPKSASGKILRRELIEKVRSKM 543 >gb|AHL44983.1| 4-coumarate:coenzyme A ligase 4 [Fraxinus mandshurica] Length = 543 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +3 Query: 3 FKRLRRVTFINSVPKSVSGKILRRELIAKVRSKM 104 FKRLRRVTF NSVPKS SGKILRRELIAKVRSK+ Sbjct: 510 FKRLRRVTFTNSVPKSASGKILRRELIAKVRSKL 543 >ref|XP_006488029.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like [Citrus sinensis] Length = 546 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +3 Query: 3 FKRLRRVTFINSVPKSVSGKILRRELIAKVRSKM 104 +KRLR+VTFINSVPKS SGKILRRELIAKVRSK+ Sbjct: 513 YKRLRKVTFINSVPKSASGKILRRELIAKVRSKI 546 >ref|XP_006424485.1| hypothetical protein CICLE_v100281391mg, partial [Citrus clementina] gi|567863664|ref|XP_006424486.1| hypothetical protein CICLE_v100281391mg, partial [Citrus clementina] gi|557526419|gb|ESR37725.1| hypothetical protein CICLE_v100281391mg, partial [Citrus clementina] gi|557526420|gb|ESR37726.1| hypothetical protein CICLE_v100281391mg, partial [Citrus clementina] Length = 206 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +3 Query: 3 FKRLRRVTFINSVPKSVSGKILRRELIAKVRSKM 104 +KRLR+VTFINSVPKS SGKILRRELIAKVRSK+ Sbjct: 173 YKRLRKVTFINSVPKSASGKILRRELIAKVRSKI 206 >ref|XP_007016849.1| AMP-dependent synthetase and ligase family protein isoform 1 [Theobroma cacao] gi|508787212|gb|EOY34468.1| AMP-dependent synthetase and ligase family protein isoform 1 [Theobroma cacao] Length = 545 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +3 Query: 3 FKRLRRVTFINSVPKSVSGKILRRELIAKVRSKM 104 FKRLRRVTFI+SVPKS SGKILRRELI KVRSKM Sbjct: 512 FKRLRRVTFISSVPKSASGKILRRELIEKVRSKM 545 >ref|XP_007208457.1| hypothetical protein PRUPE_ppa003893mg [Prunus persica] gi|462404099|gb|EMJ09656.1| hypothetical protein PRUPE_ppa003893mg [Prunus persica] Length = 542 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +3 Query: 3 FKRLRRVTFINSVPKSVSGKILRRELIAKVRSKM 104 FKRLRRVTFINSVPKS SGKILRRELI KVRSK+ Sbjct: 509 FKRLRRVTFINSVPKSASGKILRRELIDKVRSKI 542 >ref|XP_006373451.1| 4-coumarate--CoA ligase family protein [Populus trichocarpa] gi|550320273|gb|ERP51248.1| 4-coumarate--CoA ligase family protein [Populus trichocarpa] Length = 543 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +3 Query: 3 FKRLRRVTFINSVPKSVSGKILRRELIAKVRSKM 104 FKRLR+VTFINSVPKS SGKILRREL+ KV+SKM Sbjct: 510 FKRLRKVTFINSVPKSASGKILRRELVQKVKSKM 543 >gb|AGO89327.1| Ca4CL10 [Salix arbutifolia] Length = 548 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +3 Query: 3 FKRLRRVTFINSVPKSVSGKILRRELIAKVRSKM 104 FKRLR+VTFINSVPKS SGKILRREL+ KV+SKM Sbjct: 515 FKRLRKVTFINSVPKSASGKILRRELVQKVKSKM 548 >ref|XP_004291645.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like [Fragaria vesca subsp. vesca] Length = 543 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 3 FKRLRRVTFINSVPKSVSGKILRRELIAKVRSKM 104 FKRLRRVTFIN+VPKS SGKILRRELI KVRSK+ Sbjct: 510 FKRLRRVTFINTVPKSASGKILRRELIEKVRSKI 543 >ref|XP_002266472.2| PREDICTED: 4-coumarate--CoA ligase-like 7-like [Vitis vinifera] Length = 587 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 3 FKRLRRVTFINSVPKSVSGKILRRELIAKVRSKM 104 FKRLRRVTFIN+VPKS SGKILRRELI KVRSK+ Sbjct: 554 FKRLRRVTFINNVPKSASGKILRRELIEKVRSKI 587 >emb|CBI30139.3| unnamed protein product [Vitis vinifera] Length = 649 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 3 FKRLRRVTFINSVPKSVSGKILRRELIAKVRSKM 104 FKRLRRVTFIN+VPKS SGKILRRELI KVRSK+ Sbjct: 616 FKRLRRVTFINNVPKSASGKILRRELIEKVRSKI 649 >gb|AFD33347.1| acyl-activating enzyme 3 [Cannabis sativa] Length = 543 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +3 Query: 3 FKRLRRVTFINSVPKSVSGKILRRELIAKVRSKM 104 FKRLR+VTFINSVPKS SGKILRRELI KVRS M Sbjct: 510 FKRLRKVTFINSVPKSASGKILRRELIQKVRSNM 543 >gb|AGW27195.1| 4-coumarate:coenzyme A ligase 5 [Salvia miltiorrhiza] Length = 545 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +3 Query: 3 FKRLRRVTFINSVPKSVSGKILRRELIAKVRSKM 104 FKRLRRVTFINSVPKS SGKILRRELI KVRS + Sbjct: 512 FKRLRRVTFINSVPKSASGKILRRELIDKVRSNL 545 >ref|XP_002523698.1| AMP dependent CoA ligase, putative [Ricinus communis] gi|223537002|gb|EEF38638.1| AMP dependent CoA ligase, putative [Ricinus communis] Length = 542 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +3 Query: 3 FKRLRRVTFINSVPKSVSGKILRRELIAKVRSKM 104 FKRLRRVTFIN+VPKS SGKILRRELI KV+SK+ Sbjct: 509 FKRLRRVTFINTVPKSASGKILRRELIEKVKSKL 542 >ref|XP_007150153.1| hypothetical protein PHAVU_005G131400g [Phaseolus vulgaris] gi|561023417|gb|ESW22147.1| hypothetical protein PHAVU_005G131400g [Phaseolus vulgaris] Length = 536 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +3 Query: 3 FKRLRRVTFINSVPKSVSGKILRRELIAKVRSKM 104 FKRLRRVTFIN+VPK+ SGKILRRELI KVRSK+ Sbjct: 503 FKRLRRVTFINAVPKTASGKILRRELIEKVRSKI 536 >gb|AGW47869.1| 4-coumarate:coenzyme A ligase 4 [Phaseolus vulgaris] Length = 536 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +3 Query: 3 FKRLRRVTFINSVPKSVSGKILRRELIAKVRSKM 104 FKRLRRVTFIN+VPK+ SGKILRRELI KVRSK+ Sbjct: 503 FKRLRRVTFINAVPKTASGKILRRELIEKVRSKI 536 >ref|XP_004251107.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like [Solanum lycopersicum] Length = 538 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +3 Query: 3 FKRLRRVTFINSVPKSVSGKILRRELIAKVRSKM 104 FKRL++VTFINSVPKS SGKILRRELI KVRSK+ Sbjct: 505 FKRLKKVTFINSVPKSASGKILRRELIDKVRSKI 538 >ref|XP_004147290.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like [Cucumis sativus] gi|449528351|ref|XP_004171168.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like [Cucumis sativus] Length = 543 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +3 Query: 3 FKRLRRVTFINSVPKSVSGKILRRELIAKVRSKM 104 +KRLRRVTFI+SVPKSVSGKILRRELI KVR+K+ Sbjct: 510 YKRLRRVTFISSVPKSVSGKILRRELIEKVRAKI 543