BLASTX nr result
ID: Papaver25_contig00027780
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00027780 (1187 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003589600.1| hypothetical protein MTR_1g030500 [Medicago ... 58 7e-06 >ref|XP_003589600.1| hypothetical protein MTR_1g030500 [Medicago truncatula] gi|355478648|gb|AES59851.1| hypothetical protein MTR_1g030500 [Medicago truncatula] Length = 86 Score = 58.2 bits (139), Expect = 7e-06 Identities = 29/56 (51%), Positives = 37/56 (66%), Gaps = 3/56 (5%) Frame = +2 Query: 917 WFYGVVVSTQDFESCDLGSTPGRTFSLFIYFYPVLHS---IYSSYSLAKVRDYFLF 1075 WFYGVVVST DFES DLGSTPGRT + F+P+ ++ ++ AK R F+F Sbjct: 5 WFYGVVVSTLDFESSDLGSTPGRTSLIIFLFFPLTNNYPYFFNFAGYAKGRTNFMF 60