BLASTX nr result
ID: Papaver25_contig00027386
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00027386 (431 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002456324.1| hypothetical protein SORBIDRAFT_03g033990 [S... 56 6e-06 >ref|XP_002456324.1| hypothetical protein SORBIDRAFT_03g033990 [Sorghum bicolor] gi|241928299|gb|EES01444.1| hypothetical protein SORBIDRAFT_03g033990 [Sorghum bicolor] Length = 165 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/79 (35%), Positives = 46/79 (58%) Frame = -1 Query: 326 IKTVVTKDAETVDHWIEQLYSDYKETLDRCAKTENSWARHRFIVALDVEWKPAAFASKYD 147 I T +T + VD W++++Y ++ L R +V LDVEW+P+ S+YD Sbjct: 24 ILTTLTDSGDVVDSWLDEIYRIHRRRLKR------------LVVGLDVEWRPSY--SRYD 69 Query: 146 YPPLSILKLCVGG*RCLIF 90 PP+++L++CV RCL+F Sbjct: 70 APPVAVLQMCVDH-RCLVF 87