BLASTX nr result
ID: Papaver25_contig00025699
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00025699 (419 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAO57292.1| gamma-glutamyl hydrolase [Ipomoea nil] 60 2e-07 ref|XP_004294089.1| PREDICTED: gamma-glutamyl hydrolase-like [Fr... 59 5e-07 ref|XP_006360033.1| PREDICTED: gamma-glutamyl hydrolase 2-like [... 59 7e-07 ref|NP_001234440.1| gamma-glutamylhydrolase 2 [Solanum lycopersi... 59 7e-07 gb|EYU29531.1| hypothetical protein MIMGU_mgv1a009742mg [Mimulus... 58 2e-06 ref|XP_007213890.1| hypothetical protein PRUPE_ppa006962mg [Prun... 57 3e-06 gb|EXC10782.1| Gamma-glutamyl hydrolase [Morus notabilis] 56 6e-06 ref|XP_007149562.1| hypothetical protein PHAVU_005G080700g [Phas... 56 6e-06 ref|XP_006442406.1| hypothetical protein CICLE_v10020608mg [Citr... 56 6e-06 ref|XP_006442405.1| hypothetical protein CICLE_v10020608mg [Citr... 56 6e-06 ref|XP_006442404.1| hypothetical protein CICLE_v10020608mg [Citr... 56 6e-06 ref|XP_006442396.1| hypothetical protein CICLE_v10021719mg [Citr... 56 6e-06 ref|XP_006301184.1| hypothetical protein CARUB_v10021583mg, part... 55 8e-06 >dbj|BAO57292.1| gamma-glutamyl hydrolase [Ipomoea nil] Length = 343 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = +3 Query: 30 YEQTSNLRQRVLKRNDAGDHFPLLAICLGFELLSMVISK 146 +E + Q+VL++NDAGDHFPLLAICLGFELL+M+I+K Sbjct: 123 FEVVKGIFQKVLEKNDAGDHFPLLAICLGFELLTMIITK 161 >ref|XP_004294089.1| PREDICTED: gamma-glutamyl hydrolase-like [Fragaria vesca subsp. vesca] Length = 388 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = +3 Query: 24 RTYEQTSNLRQRVLKRNDAGDHFPLLAICLGFELLSMVISK 146 R Y+ + + +L+RNDAGDHFPL AICLGFELL+M+ISK Sbjct: 167 RYYDVAEKIFKMILERNDAGDHFPLYAICLGFELLTMIISK 207 >ref|XP_006360033.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Solanum tuberosum] Length = 344 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/39 (64%), Positives = 34/39 (87%) Frame = +3 Query: 30 YEQTSNLRQRVLKRNDAGDHFPLLAICLGFELLSMVISK 146 +E + ++VL++NDAG+HFPLLAICLGFELL+M+ISK Sbjct: 123 FEVVKGIFEKVLEKNDAGEHFPLLAICLGFELLTMIISK 161 >ref|NP_001234440.1| gamma-glutamylhydrolase 2 [Solanum lycopersicum] gi|186695438|gb|ACC86850.1| gamma-glutamylhydrolase 2 [Solanum lycopersicum] Length = 344 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/39 (64%), Positives = 34/39 (87%) Frame = +3 Query: 30 YEQTSNLRQRVLKRNDAGDHFPLLAICLGFELLSMVISK 146 +E + ++VL++NDAG+HFPLLAICLGFELL+M+ISK Sbjct: 123 FEVVKGIFEKVLEKNDAGEHFPLLAICLGFELLTMIISK 161 >gb|EYU29531.1| hypothetical protein MIMGU_mgv1a009742mg [Mimulus guttatus] Length = 333 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/39 (58%), Positives = 33/39 (84%) Frame = +3 Query: 30 YEQTSNLRQRVLKRNDAGDHFPLLAICLGFELLSMVISK 146 +E ++ + V+K+ND GDHFPLLA+CLGFELL+M++SK Sbjct: 118 FEVVESIFKNVVKKNDGGDHFPLLAVCLGFELLAMIVSK 156 >ref|XP_007213890.1| hypothetical protein PRUPE_ppa006962mg [Prunus persica] gi|462409755|gb|EMJ15089.1| hypothetical protein PRUPE_ppa006962mg [Prunus persica] Length = 388 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/39 (58%), Positives = 32/39 (82%) Frame = +3 Query: 30 YEQTSNLRQRVLKRNDAGDHFPLLAICLGFELLSMVISK 146 Y+ + Q+++++NDAGDHFPL A CLGFELL+M+ISK Sbjct: 169 YDIVERIFQKIIEKNDAGDHFPLYATCLGFELLTMIISK 207 >gb|EXC10782.1| Gamma-glutamyl hydrolase [Morus notabilis] Length = 401 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/39 (61%), Positives = 33/39 (84%) Frame = +3 Query: 30 YEQTSNLRQRVLKRNDAGDHFPLLAICLGFELLSMVISK 146 YE + ++VL+RNDAG++FPL AICLGFE+L+M+ISK Sbjct: 185 YEIVERIFKKVLERNDAGEYFPLYAICLGFEILTMIISK 223 >ref|XP_007149562.1| hypothetical protein PHAVU_005G080700g [Phaseolus vulgaris] gi|561022826|gb|ESW21556.1| hypothetical protein PHAVU_005G080700g [Phaseolus vulgaris] Length = 342 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/39 (53%), Positives = 34/39 (87%) Frame = +3 Query: 30 YEQTSNLRQRVLKRNDAGDHFPLLAICLGFELLSMVISK 146 +E + + +++L++NDAGDHFPL A+CLGFEL++M+IS+ Sbjct: 128 FETVTKIFKKILEKNDAGDHFPLYAVCLGFELITMIISE 166 >ref|XP_006442406.1| hypothetical protein CICLE_v10020608mg [Citrus clementina] gi|557544668|gb|ESR55646.1| hypothetical protein CICLE_v10020608mg [Citrus clementina] Length = 328 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/39 (56%), Positives = 33/39 (84%) Frame = +3 Query: 30 YEQTSNLRQRVLKRNDAGDHFPLLAICLGFELLSMVISK 146 Y+ + +++L++NDAGDHFP+ AICLGFELLSM++S+ Sbjct: 168 YDIVEKIFKKILEKNDAGDHFPVYAICLGFELLSMIVSE 206 >ref|XP_006442405.1| hypothetical protein CICLE_v10020608mg [Citrus clementina] gi|557544667|gb|ESR55645.1| hypothetical protein CICLE_v10020608mg [Citrus clementina] Length = 291 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/39 (56%), Positives = 33/39 (84%) Frame = +3 Query: 30 YEQTSNLRQRVLKRNDAGDHFPLLAICLGFELLSMVISK 146 Y+ + +++L++NDAGDHFP+ AICLGFELLSM++S+ Sbjct: 168 YDIVEKIFKKILEKNDAGDHFPVYAICLGFELLSMIVSE 206 >ref|XP_006442404.1| hypothetical protein CICLE_v10020608mg [Citrus clementina] gi|567899838|ref|XP_006442407.1| hypothetical protein CICLE_v10020608mg [Citrus clementina] gi|557544666|gb|ESR55644.1| hypothetical protein CICLE_v10020608mg [Citrus clementina] gi|557544669|gb|ESR55647.1| hypothetical protein CICLE_v10020608mg [Citrus clementina] Length = 380 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/39 (56%), Positives = 33/39 (84%) Frame = +3 Query: 30 YEQTSNLRQRVLKRNDAGDHFPLLAICLGFELLSMVISK 146 Y+ + +++L++NDAGDHFP+ AICLGFELLSM++S+ Sbjct: 168 YDIVEKIFKKILEKNDAGDHFPVYAICLGFELLSMIVSE 206 >ref|XP_006442396.1| hypothetical protein CICLE_v10021719mg [Citrus clementina] gi|557544658|gb|ESR55636.1| hypothetical protein CICLE_v10021719mg [Citrus clementina] Length = 265 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/39 (56%), Positives = 33/39 (84%) Frame = +3 Query: 30 YEQTSNLRQRVLKRNDAGDHFPLLAICLGFELLSMVISK 146 Y+ + +++L++NDAGDHFP+ AICLGFELLSM++S+ Sbjct: 142 YDIVEKIFKKILEKNDAGDHFPVYAICLGFELLSMIVSE 180 >ref|XP_006301184.1| hypothetical protein CARUB_v10021583mg, partial [Capsella rubella] gi|482569894|gb|EOA34082.1| hypothetical protein CARUB_v10021583mg, partial [Capsella rubella] Length = 276 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/39 (61%), Positives = 32/39 (82%) Frame = +3 Query: 30 YEQTSNLRQRVLKRNDAGDHFPLLAICLGFELLSMVISK 146 +E + +VL+RNDAG+HFPL AICLGFELL+M+IS+ Sbjct: 135 FEIVKKIFNKVLERNDAGEHFPLYAICLGFELLTMIISQ 173