BLASTX nr result
ID: Papaver25_contig00025539
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00025539 (476 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007226570.1| hypothetical protein PRUPE_ppa024322mg [Prun... 61 1e-07 ref|XP_003576727.1| PREDICTED: uncharacterized protein LOC100823... 55 8e-06 >ref|XP_007226570.1| hypothetical protein PRUPE_ppa024322mg [Prunus persica] gi|462423506|gb|EMJ27769.1| hypothetical protein PRUPE_ppa024322mg [Prunus persica] Length = 309 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = +3 Query: 3 SIPFDDLKRLGIPPPPEGRYMTLHQVXXXXXXXXNSVDREE 125 SIP+DDL+RLGIPPPPEGRYM+ +QV NSVDREE Sbjct: 180 SIPYDDLERLGIPPPPEGRYMSRYQVPSPPRRKRNSVDREE 220 >ref|XP_003576727.1| PREDICTED: uncharacterized protein LOC100823301 [Brachypodium distachyon] Length = 416 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/40 (57%), Positives = 31/40 (77%) Frame = +3 Query: 6 IPFDDLKRLGIPPPPEGRYMTLHQVXXXXXXXXNSVDREE 125 IP+D+LK+LGIPPPPEGRYMT ++V +++DREE Sbjct: 182 IPYDELKKLGIPPPPEGRYMTRYEVPPLPRRKGSNIDREE 221